Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A095C200

Protein Details
Accession A0A095C200    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-63QYVLVKKKQRGKKRSAKKNGDAEQNHydrophilic
NLS Segment(s)
PositionSequence
44-56KKKQRGKKRSAKK
81-96TKRKGEGEERQGKKRR
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MIADDGKCVRPKMSHSPYLQITLSAKPLEDLERKGATCQYVLVKKKQRGKKRSAKKNGDAEQNEGSRQEAEDSDSVESRGTKRKGEGEERQGKKRRTDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.54
4 0.53
5 0.54
6 0.47
7 0.38
8 0.33
9 0.26
10 0.27
11 0.2
12 0.18
13 0.14
14 0.16
15 0.18
16 0.19
17 0.2
18 0.21
19 0.24
20 0.24
21 0.25
22 0.25
23 0.21
24 0.18
25 0.17
26 0.18
27 0.22
28 0.25
29 0.32
30 0.39
31 0.44
32 0.53
33 0.59
34 0.64
35 0.65
36 0.72
37 0.74
38 0.77
39 0.82
40 0.84
41 0.85
42 0.83
43 0.84
44 0.8
45 0.79
46 0.7
47 0.63
48 0.57
49 0.49
50 0.41
51 0.32
52 0.26
53 0.17
54 0.16
55 0.14
56 0.09
57 0.11
58 0.11
59 0.12
60 0.13
61 0.13
62 0.13
63 0.13
64 0.14
65 0.14
66 0.23
67 0.24
68 0.26
69 0.3
70 0.37
71 0.43
72 0.51
73 0.57
74 0.58
75 0.67
76 0.69
77 0.75
78 0.77
79 0.75