Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EPV3

Protein Details
Accession A7EPV3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-25SRDCSQKKPFAAKGKKQVRFGNRRHydrophilic
NLS Segment(s)
PositionSequence
14-18KGKKQ
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 10, cyto 6
Family & Domain DBs
KEGG ssl:SS1G_07352  -  
Amino Acid Sequences MSRDCSQKKPFAAKGKKQVRFGNRRQGSREAGALEGSFRETGLLEKELPQLYPEQLEELGIATLSIGVELSEDIDEEIESIGNLESVEEPIKEGSTVGYEGSQQMAEDLLRPQENELYDYDLVIGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.82
4 0.81
5 0.81
6 0.8
7 0.8
8 0.79
9 0.79
10 0.76
11 0.74
12 0.72
13 0.69
14 0.64
15 0.55
16 0.5
17 0.39
18 0.33
19 0.28
20 0.23
21 0.17
22 0.12
23 0.11
24 0.09
25 0.07
26 0.07
27 0.06
28 0.07
29 0.09
30 0.1
31 0.1
32 0.11
33 0.15
34 0.15
35 0.15
36 0.15
37 0.14
38 0.13
39 0.13
40 0.11
41 0.09
42 0.08
43 0.08
44 0.08
45 0.07
46 0.06
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.06
74 0.07
75 0.06
76 0.07
77 0.07
78 0.08
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.07
85 0.08
86 0.08
87 0.08
88 0.1
89 0.09
90 0.07
91 0.07
92 0.08
93 0.07
94 0.08
95 0.09
96 0.13
97 0.14
98 0.14
99 0.15
100 0.19
101 0.2
102 0.2
103 0.2
104 0.21
105 0.2
106 0.2
107 0.19