Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084FW11

Protein Details
Accession A0A084FW11   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-69EPKEEKPKKQNSSSSRRSPRSKKSHKTBasic
NLS Segment(s)
PositionSequence
47-69EKPKKQNSSSSRRSPRSKKSHKT
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
KEGG sapo:SAPIO_CDS9947  -  
Amino Acid Sequences METPDWKGPTFEKEVVTPLERDRHGKGYTDETDPDEPNGTVVEPKEEKPKKQNSSSSRRSPRSKKSHKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.31
4 0.27
5 0.24
6 0.27
7 0.26
8 0.29
9 0.29
10 0.31
11 0.3
12 0.31
13 0.31
14 0.31
15 0.32
16 0.31
17 0.28
18 0.26
19 0.27
20 0.25
21 0.23
22 0.18
23 0.15
24 0.13
25 0.12
26 0.09
27 0.08
28 0.07
29 0.12
30 0.12
31 0.14
32 0.25
33 0.28
34 0.33
35 0.41
36 0.51
37 0.54
38 0.61
39 0.69
40 0.68
41 0.74
42 0.79
43 0.8
44 0.81
45 0.82
46 0.84
47 0.84
48 0.86
49 0.87