Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E7K6

Protein Details
Accession A7E7K6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-36AIEAIRKDKKLKFRSKSHNLTDLEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006600  HTH_CenpB_DNA-bd_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ssl:SS1G_01284  -  
Pfam View protein in Pfam  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MQSNNKEAQILLAIEAIRKDKKLKFRSKSHNLTDLEEEVLIQYIFDVDERGFSPRISDVEDMANYILETRGVKKVGKLWAHRFVKRYTELKMCFNRIYDFQKALCEDSELIERWFRLILNMQAKYGILDCDFYNFDETGFMMGQISSHIVVTKADRCGRSKAIQSGNRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.19
4 0.18
5 0.19
6 0.25
7 0.29
8 0.4
9 0.49
10 0.59
11 0.63
12 0.72
13 0.8
14 0.84
15 0.87
16 0.83
17 0.82
18 0.73
19 0.67
20 0.6
21 0.51
22 0.41
23 0.31
24 0.24
25 0.16
26 0.14
27 0.11
28 0.07
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.04
35 0.06
36 0.07
37 0.1
38 0.11
39 0.1
40 0.12
41 0.13
42 0.14
43 0.15
44 0.15
45 0.13
46 0.15
47 0.15
48 0.14
49 0.13
50 0.12
51 0.08
52 0.08
53 0.07
54 0.05
55 0.06
56 0.07
57 0.1
58 0.12
59 0.12
60 0.13
61 0.19
62 0.25
63 0.3
64 0.34
65 0.37
66 0.45
67 0.5
68 0.51
69 0.49
70 0.44
71 0.44
72 0.43
73 0.39
74 0.33
75 0.36
76 0.35
77 0.39
78 0.41
79 0.39
80 0.35
81 0.34
82 0.32
83 0.29
84 0.31
85 0.27
86 0.25
87 0.22
88 0.24
89 0.23
90 0.23
91 0.19
92 0.16
93 0.13
94 0.13
95 0.15
96 0.13
97 0.13
98 0.13
99 0.13
100 0.12
101 0.12
102 0.11
103 0.1
104 0.12
105 0.18
106 0.24
107 0.25
108 0.25
109 0.25
110 0.25
111 0.24
112 0.21
113 0.16
114 0.08
115 0.09
116 0.09
117 0.12
118 0.12
119 0.13
120 0.14
121 0.13
122 0.13
123 0.12
124 0.12
125 0.11
126 0.1
127 0.1
128 0.07
129 0.07
130 0.07
131 0.07
132 0.08
133 0.07
134 0.07
135 0.08
136 0.08
137 0.09
138 0.14
139 0.18
140 0.24
141 0.29
142 0.33
143 0.35
144 0.41
145 0.46
146 0.49
147 0.51
148 0.53
149 0.58