Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F4V1

Protein Details
Accession A7F4V1   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
107-127ERAEIARKARLKKEKCKRRRSBasic
NLS Segment(s)
PositionSequence
112-127ARKARLKKEKCKRRRS
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
KEGG ssl:SS1G_12626  -  
Amino Acid Sequences MAAKKKKLTNASASSGLSTRIISLSPLNAENQSPLGKKDQIIKRQEDEEVPRNWPLQPPMIEDCSSEKCSRWDSNTDSGSEGFLDDDMDFLPTGWGKDDKQSNDDEERAEIARKARLKKEKCKRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.34
4 0.25
5 0.19
6 0.15
7 0.11
8 0.11
9 0.1
10 0.11
11 0.11
12 0.13
13 0.14
14 0.14
15 0.15
16 0.15
17 0.14
18 0.15
19 0.17
20 0.15
21 0.16
22 0.19
23 0.2
24 0.21
25 0.3
26 0.36
27 0.41
28 0.46
29 0.49
30 0.47
31 0.47
32 0.47
33 0.41
34 0.39
35 0.37
36 0.33
37 0.31
38 0.29
39 0.28
40 0.27
41 0.26
42 0.21
43 0.2
44 0.19
45 0.2
46 0.21
47 0.23
48 0.22
49 0.21
50 0.22
51 0.21
52 0.23
53 0.2
54 0.18
55 0.18
56 0.22
57 0.24
58 0.24
59 0.25
60 0.27
61 0.33
62 0.34
63 0.33
64 0.29
65 0.27
66 0.24
67 0.19
68 0.15
69 0.08
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.08
82 0.11
83 0.11
84 0.18
85 0.24
86 0.26
87 0.29
88 0.31
89 0.34
90 0.36
91 0.37
92 0.31
93 0.26
94 0.25
95 0.24
96 0.23
97 0.21
98 0.19
99 0.25
100 0.3
101 0.36
102 0.43
103 0.53
104 0.6
105 0.69
106 0.77
107 0.81