Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084G904

Protein Details
Accession A0A084G904    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-52VVSSSANKKVKRSRRQPTRRSPRLERLYPGHydrophilic
NLS Segment(s)
PositionSequence
30-48KKVKRSRRQPTRRSPRLER
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
KEGG sapo:SAPIO_CDS3971  -  
Amino Acid Sequences MAPRRQAAKRKSVRDDYSDVSDVVSSSANKKVKRSRRQPTRRSPRLERLYPGAENGRGKGGPSLERTGENGLSLGEDEELHPVRAMAKVDKAASQHRSGQNETRRSAKCLSQFLKKQKSEEDSLTEFVQKKIAQMENFTSAFTKEINSKCSKLSTMLDSPSEMPTDIGAQPLYRQGQETLALCRDILKHYEETNKLTQGEKYALPASSSDEDKGQVLEITNMAAGIGRKLVERAFKASHVGGGGLGIPEPKTDKERLAHSFLAKSLASHQEKPWGEEVWVVWKAWHCISNGIRGSDALHPPPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.67
4 0.64
5 0.56
6 0.46
7 0.37
8 0.31
9 0.24
10 0.2
11 0.18
12 0.13
13 0.13
14 0.22
15 0.27
16 0.29
17 0.37
18 0.47
19 0.55
20 0.65
21 0.73
22 0.76
23 0.82
24 0.91
25 0.93
26 0.94
27 0.95
28 0.93
29 0.92
30 0.9
31 0.89
32 0.88
33 0.82
34 0.75
35 0.7
36 0.66
37 0.57
38 0.52
39 0.45
40 0.4
41 0.36
42 0.33
43 0.3
44 0.25
45 0.25
46 0.24
47 0.23
48 0.23
49 0.26
50 0.28
51 0.26
52 0.27
53 0.28
54 0.29
55 0.26
56 0.21
57 0.17
58 0.13
59 0.11
60 0.11
61 0.09
62 0.06
63 0.06
64 0.06
65 0.1
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.13
72 0.15
73 0.13
74 0.15
75 0.17
76 0.18
77 0.2
78 0.22
79 0.25
80 0.27
81 0.28
82 0.33
83 0.36
84 0.39
85 0.4
86 0.46
87 0.48
88 0.51
89 0.49
90 0.5
91 0.47
92 0.47
93 0.47
94 0.43
95 0.41
96 0.43
97 0.45
98 0.45
99 0.51
100 0.57
101 0.64
102 0.61
103 0.57
104 0.54
105 0.55
106 0.5
107 0.45
108 0.41
109 0.33
110 0.32
111 0.3
112 0.29
113 0.25
114 0.21
115 0.22
116 0.17
117 0.16
118 0.2
119 0.22
120 0.19
121 0.2
122 0.22
123 0.23
124 0.23
125 0.22
126 0.17
127 0.14
128 0.14
129 0.12
130 0.11
131 0.12
132 0.14
133 0.19
134 0.21
135 0.22
136 0.23
137 0.24
138 0.23
139 0.2
140 0.2
141 0.19
142 0.19
143 0.19
144 0.19
145 0.18
146 0.19
147 0.17
148 0.15
149 0.11
150 0.09
151 0.07
152 0.09
153 0.08
154 0.08
155 0.07
156 0.07
157 0.07
158 0.11
159 0.12
160 0.1
161 0.11
162 0.11
163 0.12
164 0.14
165 0.15
166 0.14
167 0.14
168 0.14
169 0.12
170 0.13
171 0.13
172 0.13
173 0.14
174 0.14
175 0.15
176 0.17
177 0.24
178 0.25
179 0.28
180 0.3
181 0.3
182 0.29
183 0.28
184 0.26
185 0.22
186 0.23
187 0.19
188 0.18
189 0.18
190 0.17
191 0.16
192 0.16
193 0.17
194 0.17
195 0.18
196 0.16
197 0.14
198 0.15
199 0.15
200 0.14
201 0.11
202 0.09
203 0.09
204 0.09
205 0.08
206 0.08
207 0.07
208 0.07
209 0.06
210 0.06
211 0.06
212 0.06
213 0.07
214 0.07
215 0.07
216 0.09
217 0.11
218 0.15
219 0.17
220 0.22
221 0.23
222 0.24
223 0.27
224 0.26
225 0.25
226 0.2
227 0.18
228 0.13
229 0.11
230 0.11
231 0.07
232 0.07
233 0.07
234 0.06
235 0.07
236 0.1
237 0.12
238 0.16
239 0.18
240 0.23
241 0.26
242 0.33
243 0.37
244 0.41
245 0.42
246 0.41
247 0.41
248 0.37
249 0.37
250 0.3
251 0.25
252 0.25
253 0.31
254 0.33
255 0.34
256 0.35
257 0.4
258 0.41
259 0.44
260 0.42
261 0.34
262 0.29
263 0.28
264 0.28
265 0.26
266 0.27
267 0.23
268 0.22
269 0.24
270 0.27
271 0.28
272 0.3
273 0.23
274 0.3
275 0.32
276 0.39
277 0.41
278 0.39
279 0.36
280 0.33
281 0.35
282 0.33
283 0.37
284 0.31