Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084G189

Protein Details
Accession A0A084G189    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MFTSEYKQPRKVKSRKSRSNLKRMDPDCHydrophilic
NLS Segment(s)
PositionSequence
10-18RKVKSRKSR
209-217PPMGRRTPG
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
KEGG sapo:SAPIO_CDS7164  -  
Amino Acid Sequences MFTSEYKQPRKVKSRKSRSNLKRMDPDCAICNGAASLRCDCEAKALETAISQAERRMMQSIYQEIRSWARGHAQDYILEYFNVLSERRKAAHTEHIERISQAAYYHYRSPPHPAQVAEAEAILKRGIDEDWKTSVQRYPEVLEYYFSLVELTLPPEDHPSVKDPPLSALSGSRKNGRRPPPPAATIAGGAFHPQEHLPSRSSPPPPPPPPMGRRTPGPPRTSRNSYRGPPPPPPTFYGPQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.91
4 0.91
5 0.91
6 0.92
7 0.9
8 0.87
9 0.86
10 0.77
11 0.76
12 0.69
13 0.62
14 0.54
15 0.47
16 0.39
17 0.28
18 0.27
19 0.2
20 0.18
21 0.17
22 0.17
23 0.17
24 0.17
25 0.18
26 0.18
27 0.18
28 0.21
29 0.21
30 0.21
31 0.2
32 0.19
33 0.19
34 0.18
35 0.19
36 0.14
37 0.13
38 0.11
39 0.11
40 0.13
41 0.14
42 0.15
43 0.17
44 0.15
45 0.16
46 0.2
47 0.25
48 0.25
49 0.26
50 0.25
51 0.25
52 0.27
53 0.26
54 0.24
55 0.18
56 0.22
57 0.23
58 0.24
59 0.26
60 0.25
61 0.24
62 0.25
63 0.26
64 0.21
65 0.18
66 0.16
67 0.12
68 0.11
69 0.11
70 0.09
71 0.09
72 0.12
73 0.14
74 0.15
75 0.17
76 0.18
77 0.2
78 0.29
79 0.34
80 0.36
81 0.39
82 0.4
83 0.39
84 0.37
85 0.34
86 0.25
87 0.19
88 0.13
89 0.11
90 0.11
91 0.14
92 0.18
93 0.19
94 0.21
95 0.21
96 0.29
97 0.29
98 0.31
99 0.31
100 0.27
101 0.27
102 0.26
103 0.26
104 0.19
105 0.15
106 0.11
107 0.09
108 0.09
109 0.07
110 0.05
111 0.04
112 0.05
113 0.05
114 0.07
115 0.09
116 0.11
117 0.14
118 0.15
119 0.16
120 0.16
121 0.19
122 0.17
123 0.18
124 0.18
125 0.16
126 0.18
127 0.2
128 0.19
129 0.17
130 0.16
131 0.15
132 0.14
133 0.12
134 0.09
135 0.07
136 0.07
137 0.07
138 0.08
139 0.07
140 0.07
141 0.07
142 0.1
143 0.11
144 0.11
145 0.13
146 0.15
147 0.18
148 0.2
149 0.21
150 0.18
151 0.2
152 0.22
153 0.21
154 0.17
155 0.19
156 0.23
157 0.27
158 0.29
159 0.34
160 0.38
161 0.44
162 0.53
163 0.56
164 0.6
165 0.61
166 0.67
167 0.66
168 0.64
169 0.59
170 0.53
171 0.45
172 0.37
173 0.3
174 0.23
175 0.16
176 0.14
177 0.11
178 0.09
179 0.09
180 0.08
181 0.11
182 0.15
183 0.17
184 0.19
185 0.22
186 0.28
187 0.34
188 0.38
189 0.41
190 0.45
191 0.53
192 0.56
193 0.58
194 0.6
195 0.62
196 0.65
197 0.66
198 0.65
199 0.59
200 0.59
201 0.62
202 0.66
203 0.65
204 0.65
205 0.66
206 0.66
207 0.7
208 0.74
209 0.74
210 0.7
211 0.71
212 0.69
213 0.71
214 0.72
215 0.69
216 0.7
217 0.7
218 0.7
219 0.66
220 0.65
221 0.63
222 0.59