Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084GHT1

Protein Details
Accession A0A084GHT1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
74-89NRKKAAKAKAAAKKKA
Subcellular Location(s) plas 20, E.R. 4, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
KEGG sapo:SAPIO_CDS0229  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKLVGLAMLVAASVIFLYYTLWVLVMPFVDDDHVLQTLFPPRVWAIRIPVILILLGSAVVGSFIGMVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.11
27 0.12
28 0.11
29 0.12
30 0.12
31 0.13
32 0.14
33 0.14
34 0.13
35 0.16
36 0.16
37 0.15
38 0.15
39 0.13
40 0.12
41 0.11
42 0.07
43 0.04
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.05
57 0.1
58 0.16
59 0.2
60 0.24
61 0.31
62 0.36
63 0.43
64 0.5
65 0.58
66 0.61
67 0.65
68 0.72
69 0.75