Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084GDB9

Protein Details
Accession A0A084GDB9    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
371-402QVVEKKTVPKRRSLPRKKKSVPEKKKEDDDDEBasic
NLS Segment(s)
PositionSequence
375-396KKTVPKRRSLPRKKKSVPEKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027539  Mdm10  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0000002  P:mitochondrial genome maintenance  
GO:0070096  P:mitochondrial outer membrane translocase complex assembly  
GO:1990456  P:mitochondrion-endoplasmic reticulum membrane tethering  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
KEGG sapo:SAPIO_CDS2141  -  
Pfam View protein in Pfam  
PF12519  MDM10  
Amino Acid Sequences MREFMVYVQNAFYDATGWSQDNSYSTLNSTAHELLCFSTPQGLRLNLSSLATPHFATSYQLGSVGIVDGSVSYLYSSVPLKDQFTPQSESLSLPSLCRGYRTLRQLHRRDPVQAIQPIVKDGPSLLYGRLYLPQSLLEALVVKRFSSGLQLQLRAVSSKALRNGGSLLGLAQYDVGKYAVEGLASSDGGLLGLRGVYNFGGDAKEPHQNGSPEPASNGNGADRERIYGRFTAGGEIYYGTLNKSGGISCGLRFATLPSYRGTPLTATLTLNPLMGSIRASYSVMAGRHCSLATMLDFNVYSYESNWSVGVELWRKEFLRHVEEDVTTTTAVQEEVAALASTLDPAVAKAWSRSLQAKLEWRLDEPGAKAPQVVEKKTVPKRRSLPRKKKSVPEKKKEDDDDEYNGVIKARFGQNRIGILWEGRVKSLLYSVGSGIDLRNPDQPFRTLGLEIQYSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.13
5 0.13
6 0.14
7 0.15
8 0.16
9 0.19
10 0.18
11 0.16
12 0.17
13 0.21
14 0.21
15 0.2
16 0.23
17 0.22
18 0.22
19 0.21
20 0.2
21 0.17
22 0.18
23 0.18
24 0.14
25 0.19
26 0.19
27 0.21
28 0.26
29 0.26
30 0.26
31 0.27
32 0.3
33 0.23
34 0.24
35 0.22
36 0.18
37 0.19
38 0.18
39 0.17
40 0.15
41 0.14
42 0.13
43 0.15
44 0.15
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.12
51 0.1
52 0.08
53 0.06
54 0.05
55 0.04
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.07
63 0.08
64 0.09
65 0.13
66 0.15
67 0.18
68 0.21
69 0.26
70 0.29
71 0.32
72 0.36
73 0.33
74 0.34
75 0.31
76 0.3
77 0.27
78 0.26
79 0.22
80 0.18
81 0.2
82 0.19
83 0.18
84 0.19
85 0.21
86 0.22
87 0.29
88 0.36
89 0.43
90 0.49
91 0.6
92 0.65
93 0.71
94 0.73
95 0.69
96 0.66
97 0.62
98 0.58
99 0.55
100 0.5
101 0.44
102 0.39
103 0.36
104 0.33
105 0.28
106 0.23
107 0.15
108 0.13
109 0.12
110 0.11
111 0.12
112 0.1
113 0.11
114 0.11
115 0.12
116 0.16
117 0.15
118 0.14
119 0.13
120 0.13
121 0.13
122 0.13
123 0.12
124 0.08
125 0.09
126 0.09
127 0.12
128 0.11
129 0.11
130 0.11
131 0.11
132 0.11
133 0.14
134 0.15
135 0.2
136 0.23
137 0.24
138 0.24
139 0.25
140 0.26
141 0.21
142 0.2
143 0.15
144 0.14
145 0.16
146 0.19
147 0.21
148 0.2
149 0.2
150 0.21
151 0.18
152 0.16
153 0.13
154 0.1
155 0.07
156 0.07
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.05
163 0.04
164 0.04
165 0.06
166 0.06
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.03
184 0.04
185 0.04
186 0.04
187 0.05
188 0.05
189 0.07
190 0.09
191 0.14
192 0.14
193 0.15
194 0.19
195 0.19
196 0.19
197 0.23
198 0.22
199 0.17
200 0.18
201 0.18
202 0.16
203 0.16
204 0.16
205 0.1
206 0.11
207 0.11
208 0.12
209 0.1
210 0.11
211 0.11
212 0.12
213 0.13
214 0.12
215 0.12
216 0.12
217 0.13
218 0.13
219 0.11
220 0.11
221 0.09
222 0.08
223 0.08
224 0.07
225 0.07
226 0.05
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.08
234 0.09
235 0.08
236 0.11
237 0.11
238 0.1
239 0.1
240 0.11
241 0.15
242 0.16
243 0.17
244 0.15
245 0.17
246 0.17
247 0.18
248 0.17
249 0.11
250 0.12
251 0.13
252 0.14
253 0.13
254 0.13
255 0.14
256 0.14
257 0.13
258 0.11
259 0.09
260 0.08
261 0.07
262 0.07
263 0.06
264 0.06
265 0.07
266 0.07
267 0.07
268 0.08
269 0.11
270 0.11
271 0.11
272 0.12
273 0.13
274 0.13
275 0.13
276 0.12
277 0.09
278 0.1
279 0.1
280 0.1
281 0.09
282 0.09
283 0.09
284 0.09
285 0.09
286 0.08
287 0.08
288 0.07
289 0.1
290 0.1
291 0.1
292 0.1
293 0.1
294 0.1
295 0.11
296 0.15
297 0.15
298 0.16
299 0.17
300 0.2
301 0.21
302 0.21
303 0.25
304 0.26
305 0.27
306 0.27
307 0.29
308 0.29
309 0.29
310 0.29
311 0.25
312 0.21
313 0.16
314 0.14
315 0.11
316 0.09
317 0.08
318 0.07
319 0.06
320 0.05
321 0.05
322 0.05
323 0.05
324 0.04
325 0.05
326 0.05
327 0.05
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.06
334 0.07
335 0.08
336 0.12
337 0.14
338 0.17
339 0.21
340 0.25
341 0.27
342 0.31
343 0.39
344 0.4
345 0.44
346 0.42
347 0.4
348 0.39
349 0.37
350 0.35
351 0.29
352 0.31
353 0.27
354 0.26
355 0.25
356 0.22
357 0.29
358 0.32
359 0.32
360 0.29
361 0.33
362 0.43
363 0.52
364 0.61
365 0.55
366 0.58
367 0.65
368 0.71
369 0.78
370 0.8
371 0.81
372 0.81
373 0.9
374 0.89
375 0.9
376 0.9
377 0.91
378 0.9
379 0.9
380 0.9
381 0.87
382 0.89
383 0.85
384 0.8
385 0.76
386 0.69
387 0.64
388 0.56
389 0.48
390 0.4
391 0.34
392 0.29
393 0.22
394 0.17
395 0.17
396 0.24
397 0.27
398 0.29
399 0.35
400 0.39
401 0.42
402 0.42
403 0.38
404 0.31
405 0.28
406 0.31
407 0.3
408 0.26
409 0.24
410 0.24
411 0.22
412 0.21
413 0.23
414 0.2
415 0.16
416 0.17
417 0.16
418 0.16
419 0.16
420 0.16
421 0.14
422 0.16
423 0.16
424 0.17
425 0.24
426 0.24
427 0.27
428 0.3
429 0.32
430 0.31
431 0.32
432 0.34
433 0.28
434 0.28
435 0.3