Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EZ02

Protein Details
Accession A7EZ02    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-54RYSHTAEKRQCPRNDRKRLPHPSRPLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, mito_nucl 10.166, cyto 8
Family & Domain DBs
KEGG ssl:SS1G_10568  -  
Amino Acid Sequences MQKARKVDGAEHAQSLEEILIRRVELERYSHTAEKRQCPRNDRKRLPHPSRPLIYLAVPHFNKLCLLVRKTAWVIEYNRTPSVLGHELRKVYCTLNVVEHCAVRISPSLFFLNRKLETSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.17
4 0.11
5 0.09
6 0.1
7 0.1
8 0.1
9 0.11
10 0.12
11 0.14
12 0.14
13 0.16
14 0.19
15 0.23
16 0.28
17 0.31
18 0.32
19 0.37
20 0.42
21 0.48
22 0.53
23 0.58
24 0.59
25 0.64
26 0.73
27 0.76
28 0.81
29 0.8
30 0.81
31 0.83
32 0.87
33 0.87
34 0.86
35 0.83
36 0.8
37 0.73
38 0.65
39 0.56
40 0.46
41 0.38
42 0.32
43 0.25
44 0.24
45 0.22
46 0.21
47 0.19
48 0.17
49 0.17
50 0.15
51 0.19
52 0.17
53 0.19
54 0.21
55 0.21
56 0.24
57 0.24
58 0.23
59 0.19
60 0.19
61 0.19
62 0.21
63 0.25
64 0.26
65 0.26
66 0.25
67 0.24
68 0.2
69 0.24
70 0.24
71 0.21
72 0.21
73 0.25
74 0.27
75 0.27
76 0.28
77 0.23
78 0.19
79 0.21
80 0.2
81 0.18
82 0.22
83 0.23
84 0.26
85 0.26
86 0.25
87 0.23
88 0.22
89 0.2
90 0.15
91 0.18
92 0.15
93 0.15
94 0.18
95 0.22
96 0.23
97 0.25
98 0.28
99 0.32
100 0.33