Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084GA81

Protein Details
Accession A0A084GA81   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
151-173IGYREPPRGLRKGKKHPDAPYSLBasic
NLS Segment(s)
PositionSequence
159-165GLRKGKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
KEGG sapo:SAPIO_CDS3186  -  
Amino Acid Sequences MPLLSHTGRTSSGNSQTPQGEERSKIQTLITERNDETQMYSGDPQDMEIPEFVRTGSYYVTGRDEPDCKYFQASDVRRQVQQAPTTPRRFVKYLNRYHNGPRPLLHARRPFKEYPIAPSHQNGSAPGNFVCGDPGPVRAFYSESDRSEFDIGYREPPRGLRKGKKHPDAPYSLASYHPAPTYTDTSTIGRVQASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.39
5 0.38
6 0.36
7 0.33
8 0.3
9 0.34
10 0.35
11 0.34
12 0.32
13 0.3
14 0.3
15 0.32
16 0.38
17 0.37
18 0.36
19 0.35
20 0.38
21 0.39
22 0.33
23 0.3
24 0.23
25 0.21
26 0.18
27 0.19
28 0.16
29 0.16
30 0.16
31 0.14
32 0.14
33 0.14
34 0.13
35 0.12
36 0.12
37 0.12
38 0.12
39 0.11
40 0.09
41 0.08
42 0.08
43 0.08
44 0.1
45 0.09
46 0.11
47 0.14
48 0.14
49 0.15
50 0.17
51 0.18
52 0.18
53 0.22
54 0.22
55 0.19
56 0.21
57 0.19
58 0.2
59 0.28
60 0.28
61 0.33
62 0.39
63 0.41
64 0.4
65 0.41
66 0.42
67 0.38
68 0.39
69 0.37
70 0.38
71 0.44
72 0.46
73 0.47
74 0.45
75 0.43
76 0.41
77 0.4
78 0.42
79 0.44
80 0.5
81 0.56
82 0.56
83 0.54
84 0.58
85 0.59
86 0.51
87 0.43
88 0.34
89 0.31
90 0.36
91 0.37
92 0.4
93 0.43
94 0.44
95 0.47
96 0.52
97 0.47
98 0.43
99 0.46
100 0.4
101 0.37
102 0.39
103 0.37
104 0.33
105 0.33
106 0.32
107 0.26
108 0.26
109 0.2
110 0.18
111 0.17
112 0.17
113 0.16
114 0.15
115 0.14
116 0.14
117 0.14
118 0.1
119 0.12
120 0.1
121 0.14
122 0.13
123 0.13
124 0.14
125 0.13
126 0.14
127 0.13
128 0.2
129 0.22
130 0.22
131 0.24
132 0.24
133 0.26
134 0.26
135 0.25
136 0.18
137 0.19
138 0.18
139 0.22
140 0.23
141 0.22
142 0.22
143 0.28
144 0.34
145 0.37
146 0.46
147 0.49
148 0.58
149 0.68
150 0.77
151 0.81
152 0.83
153 0.82
154 0.81
155 0.78
156 0.72
157 0.65
158 0.58
159 0.5
160 0.43
161 0.38
162 0.31
163 0.27
164 0.24
165 0.2
166 0.18
167 0.22
168 0.25
169 0.25
170 0.26
171 0.26
172 0.26
173 0.29
174 0.28
175 0.25