Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084FVU6

Protein Details
Accession A0A084FVU6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
150-169GKDTPTPDGKSKKQKRSKQSBasic
NLS Segment(s)
PositionSequence
158-168GKSKKQKRSKQ
Subcellular Location(s) nucl 17.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
KEGG sapo:SAPIO_CDS9872  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MSVQDISPDLDKLEAQLDKVEATIKPLLENISNSTQLPLVDRAKLFTLTNYALEIASLRLQGADALNHPVFTTELKRVKQYFDKIEAAENPPQPQPRTQKVDTEAATRMIKAGLSDDQALKNKLAEQIAKEKAKAFLTSIGKRRPDSEQGKDTPTPDGKSKKQKRSKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.16
5 0.15
6 0.16
7 0.17
8 0.12
9 0.15
10 0.18
11 0.16
12 0.16
13 0.17
14 0.19
15 0.18
16 0.2
17 0.2
18 0.21
19 0.22
20 0.21
21 0.21
22 0.2
23 0.18
24 0.19
25 0.2
26 0.18
27 0.2
28 0.2
29 0.21
30 0.22
31 0.23
32 0.21
33 0.16
34 0.18
35 0.16
36 0.16
37 0.15
38 0.14
39 0.12
40 0.11
41 0.11
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.13
60 0.15
61 0.21
62 0.22
63 0.26
64 0.27
65 0.3
66 0.35
67 0.37
68 0.35
69 0.34
70 0.35
71 0.31
72 0.32
73 0.31
74 0.28
75 0.28
76 0.24
77 0.21
78 0.22
79 0.24
80 0.23
81 0.28
82 0.32
83 0.34
84 0.41
85 0.4
86 0.43
87 0.44
88 0.48
89 0.43
90 0.39
91 0.33
92 0.29
93 0.28
94 0.23
95 0.2
96 0.14
97 0.13
98 0.1
99 0.11
100 0.08
101 0.1
102 0.12
103 0.13
104 0.16
105 0.19
106 0.21
107 0.19
108 0.18
109 0.19
110 0.2
111 0.22
112 0.2
113 0.2
114 0.28
115 0.35
116 0.36
117 0.35
118 0.33
119 0.35
120 0.35
121 0.32
122 0.26
123 0.26
124 0.32
125 0.39
126 0.45
127 0.48
128 0.51
129 0.51
130 0.52
131 0.5
132 0.53
133 0.53
134 0.54
135 0.55
136 0.55
137 0.6
138 0.59
139 0.54
140 0.52
141 0.49
142 0.44
143 0.44
144 0.49
145 0.52
146 0.61
147 0.7
148 0.73
149 0.79