Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084G6B1

Protein Details
Accession A0A084G6B1    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
139-159EDEFERKTRLRENRRRPIEETBasic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 4, E.R. 3, mito_nucl 3, nucl 2, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039205  NDUFA11  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0016491  F:oxidoreductase activity  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
KEGG sapo:SAPIO_CDS5303  -  
Amino Acid Sequences MASHSATQEHYEPKDAVKEGVRCGAIGAGSGLFLSAIQNSLSRRNLGMMTVFTRTGHLIGFTSIAIGALGFTITAAANLREKEDHWNAALGGAVGGAIAGLSGKRMPLVVGCAAGLATVLGVFEYTGGRFDGYFNRSEEDEFERKTRLRENRRRPIEETIRDVGEGRGICPPGYEERRRERIKEKYGFEVNPVKATVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.32
5 0.33
6 0.31
7 0.36
8 0.34
9 0.28
10 0.27
11 0.25
12 0.18
13 0.15
14 0.13
15 0.07
16 0.07
17 0.07
18 0.06
19 0.04
20 0.04
21 0.05
22 0.04
23 0.05
24 0.06
25 0.08
26 0.1
27 0.16
28 0.18
29 0.19
30 0.19
31 0.2
32 0.2
33 0.19
34 0.19
35 0.15
36 0.16
37 0.16
38 0.16
39 0.14
40 0.15
41 0.14
42 0.13
43 0.11
44 0.09
45 0.08
46 0.08
47 0.09
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.04
63 0.05
64 0.07
65 0.08
66 0.09
67 0.09
68 0.1
69 0.17
70 0.19
71 0.19
72 0.17
73 0.18
74 0.16
75 0.16
76 0.15
77 0.08
78 0.06
79 0.04
80 0.04
81 0.03
82 0.02
83 0.02
84 0.01
85 0.01
86 0.01
87 0.01
88 0.02
89 0.02
90 0.02
91 0.03
92 0.03
93 0.03
94 0.04
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.06
102 0.05
103 0.03
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.03
113 0.04
114 0.05
115 0.05
116 0.05
117 0.07
118 0.12
119 0.14
120 0.16
121 0.16
122 0.18
123 0.18
124 0.19
125 0.2
126 0.21
127 0.23
128 0.23
129 0.24
130 0.26
131 0.27
132 0.3
133 0.36
134 0.4
135 0.47
136 0.56
137 0.65
138 0.72
139 0.8
140 0.83
141 0.78
142 0.78
143 0.77
144 0.72
145 0.67
146 0.59
147 0.51
148 0.46
149 0.43
150 0.32
151 0.27
152 0.21
153 0.16
154 0.17
155 0.17
156 0.17
157 0.17
158 0.19
159 0.24
160 0.32
161 0.37
162 0.41
163 0.5
164 0.6
165 0.64
166 0.68
167 0.68
168 0.71
169 0.74
170 0.75
171 0.7
172 0.68
173 0.71
174 0.66
175 0.62
176 0.61
177 0.52
178 0.47