Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084GF93

Protein Details
Accession A0A084GF93    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
231-257HVKQPATKAPKKSSGKRKQDSDEDKELHydrophilic
NLS Segment(s)
PositionSequence
223-248PMPSKPKTHVKQPATKAPKKSSGKRK
263-269RRSKRNR
Subcellular Location(s) nucl 17.5, cyto_nucl 13.833, mito_nucl 10.166, cyto 8
Family & Domain DBs
KEGG sapo:SAPIO_CDS1408  -  
Amino Acid Sequences MAHSEKVVSPADISAKEFENLLGRYPSLLQSVSDGKAAKTGQKPLVDLDHYRYVEAPETFRLDNPNRAMVQDDVKSLVEWKLRHGKFRPTLMKFVSSNDPDTVEEIIQDALEVYRDTSDASAAVDILTKLKGIGPATASLLLSVHDSERVLFFSDEAFYWLCCNGKKDPIKYNKKEYAALNAEAQKLIKRLGIKAMDLEKVAYVVINEGPGESGPKAEKGELPMPSKPKTHVKQPATKAPKKSSGKRKQDSDEDKELVTAPLRRSKRNRPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.2
5 0.19
6 0.21
7 0.2
8 0.21
9 0.2
10 0.18
11 0.19
12 0.21
13 0.21
14 0.17
15 0.17
16 0.14
17 0.17
18 0.2
19 0.2
20 0.22
21 0.21
22 0.18
23 0.23
24 0.23
25 0.27
26 0.28
27 0.34
28 0.37
29 0.38
30 0.39
31 0.37
32 0.42
33 0.38
34 0.35
35 0.34
36 0.36
37 0.34
38 0.33
39 0.31
40 0.27
41 0.29
42 0.28
43 0.24
44 0.19
45 0.22
46 0.22
47 0.23
48 0.29
49 0.27
50 0.33
51 0.33
52 0.35
53 0.31
54 0.31
55 0.33
56 0.27
57 0.28
58 0.23
59 0.21
60 0.18
61 0.18
62 0.18
63 0.17
64 0.18
65 0.18
66 0.17
67 0.22
68 0.31
69 0.32
70 0.39
71 0.41
72 0.47
73 0.49
74 0.58
75 0.62
76 0.55
77 0.59
78 0.54
79 0.55
80 0.46
81 0.44
82 0.41
83 0.33
84 0.32
85 0.27
86 0.26
87 0.22
88 0.22
89 0.2
90 0.13
91 0.11
92 0.09
93 0.08
94 0.06
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.04
116 0.05
117 0.05
118 0.07
119 0.07
120 0.09
121 0.09
122 0.09
123 0.1
124 0.11
125 0.1
126 0.08
127 0.07
128 0.06
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.06
137 0.08
138 0.07
139 0.07
140 0.07
141 0.08
142 0.08
143 0.09
144 0.08
145 0.07
146 0.07
147 0.08
148 0.09
149 0.09
150 0.12
151 0.13
152 0.22
153 0.27
154 0.32
155 0.4
156 0.5
157 0.6
158 0.62
159 0.69
160 0.68
161 0.65
162 0.65
163 0.56
164 0.55
165 0.48
166 0.44
167 0.38
168 0.34
169 0.32
170 0.28
171 0.27
172 0.2
173 0.17
174 0.17
175 0.15
176 0.14
177 0.15
178 0.21
179 0.23
180 0.21
181 0.24
182 0.26
183 0.25
184 0.24
185 0.23
186 0.16
187 0.14
188 0.13
189 0.09
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.07
197 0.07
198 0.09
199 0.08
200 0.1
201 0.1
202 0.13
203 0.14
204 0.15
205 0.17
206 0.21
207 0.26
208 0.3
209 0.33
210 0.36
211 0.4
212 0.42
213 0.42
214 0.42
215 0.47
216 0.46
217 0.52
218 0.57
219 0.61
220 0.67
221 0.72
222 0.78
223 0.77
224 0.79
225 0.77
226 0.74
227 0.76
228 0.76
229 0.79
230 0.79
231 0.8
232 0.84
233 0.85
234 0.86
235 0.84
236 0.86
237 0.85
238 0.81
239 0.79
240 0.7
241 0.61
242 0.53
243 0.46
244 0.37
245 0.32
246 0.29
247 0.26
248 0.33
249 0.37
250 0.46
251 0.54