Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084G8V5

Protein Details
Accession A0A084G8V5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-149GHDHGRRRRGGKERRKRRPSPNAYERVPKQBasic
NLS Segment(s)
PositionSequence
124-161GRRRRGGKERRKRRPSPNAYERVPKQKPQPKPEGDGSK
Subcellular Location(s) nucl 15, cyto_nucl 12, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG sapo:SAPIO_CDS3911  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MASHGQVVQRSAATTSQAQTVVTTETQTPAPPVPILRLRGAHASRRRVQWTEDVVDNEGLGRKSSKVCCIYHRPKGVDESSDESSSSSDSSSDSDSDADRKPASHKDHDHDKCPDHGDHGHDHGRRRRGGKERRKRRPSPNAYERVPKQKPQPKPEGDGSKGAEPGAQKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.19
6 0.17
7 0.17
8 0.17
9 0.15
10 0.15
11 0.12
12 0.14
13 0.14
14 0.14
15 0.15
16 0.14
17 0.15
18 0.15
19 0.15
20 0.19
21 0.23
22 0.26
23 0.26
24 0.27
25 0.27
26 0.34
27 0.36
28 0.4
29 0.42
30 0.47
31 0.49
32 0.54
33 0.57
34 0.51
35 0.5
36 0.49
37 0.47
38 0.42
39 0.39
40 0.35
41 0.31
42 0.29
43 0.26
44 0.19
45 0.16
46 0.13
47 0.11
48 0.1
49 0.1
50 0.15
51 0.17
52 0.23
53 0.25
54 0.27
55 0.32
56 0.42
57 0.48
58 0.52
59 0.56
60 0.51
61 0.48
62 0.51
63 0.46
64 0.37
65 0.31
66 0.28
67 0.24
68 0.22
69 0.21
70 0.16
71 0.15
72 0.14
73 0.12
74 0.07
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.11
84 0.12
85 0.12
86 0.12
87 0.12
88 0.15
89 0.22
90 0.27
91 0.32
92 0.36
93 0.4
94 0.51
95 0.53
96 0.55
97 0.53
98 0.49
99 0.45
100 0.44
101 0.39
102 0.32
103 0.31
104 0.29
105 0.27
106 0.3
107 0.34
108 0.33
109 0.4
110 0.43
111 0.47
112 0.49
113 0.49
114 0.53
115 0.57
116 0.65
117 0.69
118 0.73
119 0.78
120 0.84
121 0.91
122 0.91
123 0.92
124 0.92
125 0.91
126 0.91
127 0.9
128 0.87
129 0.81
130 0.82
131 0.77
132 0.77
133 0.71
134 0.66
135 0.67
136 0.67
137 0.73
138 0.72
139 0.76
140 0.72
141 0.73
142 0.77
143 0.75
144 0.7
145 0.67
146 0.62
147 0.55
148 0.5
149 0.43
150 0.35