Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084GAX4

Protein Details
Accession A0A084GAX4   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-124KESSVVLEKRRKRNTHFPQRKFAVKAHydrophilic
NLS Segment(s)
PositionSequence
86-119PKQTRAIRRRLSAKESSVVLEKRRKRNTHFPQRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG sapo:SAPIO_CDS3499  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAGQLWNKNKDELTKQLNELKTELGQLRIQKIVSSGTKLNKIHDLRKSIARVLTIINAKQRAQLRLFYKNKKYIPLDLRPKQTRAIRRRLSAKESSVVLEKRRKRNTHFPQRKFAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.59
3 0.56
4 0.53
5 0.51
6 0.48
7 0.44
8 0.44
9 0.49
10 0.5
11 0.46
12 0.41
13 0.35
14 0.28
15 0.28
16 0.25
17 0.21
18 0.21
19 0.22
20 0.23
21 0.23
22 0.23
23 0.19
24 0.19
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.38
39 0.43
40 0.43
41 0.37
42 0.35
43 0.29
44 0.24
45 0.2
46 0.21
47 0.17
48 0.17
49 0.17
50 0.18
51 0.17
52 0.21
53 0.23
54 0.23
55 0.23
56 0.27
57 0.28
58 0.37
59 0.44
60 0.47
61 0.51
62 0.56
63 0.56
64 0.57
65 0.56
66 0.54
67 0.55
68 0.56
69 0.6
70 0.58
71 0.66
72 0.63
73 0.62
74 0.61
75 0.61
76 0.61
77 0.59
78 0.64
79 0.61
80 0.64
81 0.71
82 0.7
83 0.7
84 0.66
85 0.61
86 0.54
87 0.48
88 0.43
89 0.41
90 0.38
91 0.39
92 0.42
93 0.47
94 0.54
95 0.63
96 0.68
97 0.7
98 0.78
99 0.82
100 0.84
101 0.87
102 0.83
103 0.84
104 0.83
105 0.83