Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ENV5

Protein Details
Accession A7ENV5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-67LISKLEKLKDLRNRKKQKQKHQLSEGVKPEHydrophilic
NLS Segment(s)
PositionSequence
47-57DLRNRKKQKQK
Subcellular Location(s) mito 14.5, mito_nucl 12.498, cyto_nucl 9.333, nucl 8.5
Family & Domain DBs
KEGG ssl:SS1G_07004  -  
Amino Acid Sequences MARQSFFQGKKPTKIRRVSVGGIGIMHRSIICTITQKLISKLEKLKDLRNRKKQKQKHQLSEGVKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.74
3 0.72
4 0.71
5 0.64
6 0.58
7 0.5
8 0.41
9 0.33
10 0.29
11 0.2
12 0.14
13 0.12
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.09
20 0.09
21 0.12
22 0.14
23 0.15
24 0.16
25 0.22
26 0.22
27 0.25
28 0.29
29 0.3
30 0.35
31 0.37
32 0.43
33 0.47
34 0.57
35 0.63
36 0.69
37 0.77
38 0.8
39 0.89
40 0.91
41 0.93
42 0.93
43 0.93
44 0.93
45 0.91
46 0.9
47 0.84