Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084G4Q3

Protein Details
Accession A0A084G4Q3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-83TIKVVLKTKEDRKPKKPHQAFVIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 5, mito 4, extr 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008814  Swp1  
Gene Ontology GO:0008250  C:oligosaccharyltransferase complex  
GO:0006487  P:protein N-linked glycosylation  
KEGG sapo:SAPIO_CDS5477  -  
Pfam View protein in Pfam  
PF05817  Ribophorin_II  
Amino Acid Sequences MRILQSLSTLLLVASTAYAASSWEFDDATVSIKSRKGAGLTEKFTQKATLSKALPLDTTDTIKVVLKTKEDRKPKKPHQAFVIIKEEDTGLEAPFAFAVKESGKAVVEIPRKELPVQHLLSKKPLHASIVIGSFGSSEGLVRPVFDIDLVDNPAATPPQYEKPIRYGKLPEIHHIFKAPDRVPPKIVSIFFTLAVLAPIPALFIGWIVLGANLTHLKTAFAAAPLSHAIFFGSIVAMEASFFMYHRSWNLFQLLPVAGVIGVITFLSGTKALGEVQSRRLAGER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.1
14 0.1
15 0.12
16 0.12
17 0.13
18 0.15
19 0.17
20 0.19
21 0.19
22 0.21
23 0.2
24 0.24
25 0.33
26 0.38
27 0.4
28 0.45
29 0.46
30 0.45
31 0.44
32 0.41
33 0.32
34 0.3
35 0.31
36 0.33
37 0.3
38 0.33
39 0.35
40 0.33
41 0.32
42 0.28
43 0.26
44 0.21
45 0.22
46 0.19
47 0.17
48 0.17
49 0.19
50 0.2
51 0.21
52 0.22
53 0.24
54 0.31
55 0.4
56 0.47
57 0.56
58 0.63
59 0.68
60 0.76
61 0.82
62 0.85
63 0.84
64 0.81
65 0.78
66 0.79
67 0.73
68 0.68
69 0.65
70 0.54
71 0.46
72 0.41
73 0.33
74 0.22
75 0.21
76 0.15
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.05
84 0.04
85 0.06
86 0.06
87 0.08
88 0.08
89 0.09
90 0.09
91 0.1
92 0.11
93 0.17
94 0.22
95 0.21
96 0.24
97 0.25
98 0.26
99 0.26
100 0.27
101 0.24
102 0.27
103 0.27
104 0.29
105 0.31
106 0.31
107 0.36
108 0.35
109 0.32
110 0.27
111 0.27
112 0.23
113 0.19
114 0.2
115 0.16
116 0.16
117 0.15
118 0.12
119 0.11
120 0.09
121 0.08
122 0.07
123 0.04
124 0.03
125 0.04
126 0.06
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.04
135 0.06
136 0.07
137 0.06
138 0.06
139 0.06
140 0.07
141 0.06
142 0.06
143 0.05
144 0.07
145 0.11
146 0.16
147 0.17
148 0.18
149 0.25
150 0.33
151 0.33
152 0.33
153 0.33
154 0.34
155 0.41
156 0.41
157 0.39
158 0.38
159 0.38
160 0.36
161 0.34
162 0.3
163 0.24
164 0.3
165 0.25
166 0.26
167 0.28
168 0.29
169 0.3
170 0.31
171 0.32
172 0.3
173 0.3
174 0.26
175 0.26
176 0.25
177 0.22
178 0.21
179 0.17
180 0.12
181 0.12
182 0.09
183 0.05
184 0.04
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.04
196 0.04
197 0.04
198 0.06
199 0.07
200 0.07
201 0.08
202 0.08
203 0.08
204 0.09
205 0.1
206 0.09
207 0.09
208 0.1
209 0.09
210 0.11
211 0.12
212 0.12
213 0.11
214 0.1
215 0.09
216 0.08
217 0.08
218 0.07
219 0.06
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.06
227 0.06
228 0.06
229 0.08
230 0.09
231 0.1
232 0.13
233 0.19
234 0.2
235 0.23
236 0.27
237 0.25
238 0.25
239 0.27
240 0.25
241 0.19
242 0.17
243 0.14
244 0.1
245 0.09
246 0.08
247 0.04
248 0.04
249 0.03
250 0.03
251 0.03
252 0.03
253 0.05
254 0.05
255 0.06
256 0.06
257 0.07
258 0.08
259 0.12
260 0.17
261 0.19
262 0.24
263 0.3
264 0.3