Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084FWE2

Protein Details
Accession A0A084FWE2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-31APVPKGCKVQKRPLVRQQQPASHydrophilic
NLS Segment(s)
PositionSequence
51-70RVRKRLDKAAVGGSKPPNKR
Subcellular Location(s) mito 15.5, mito_nucl 11, cyto 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
IPR020241  RNase_P/MRP_Pop7_fungi  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
KEGG sapo:SAPIO_CDS10113  -  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MTPAPKTKLAPVPKGCKVQKRPLVRQQQPASSNSRLIYVSSSTRFMAVVKRVRKRLDKAAVGGSKPPNKRMHLSARVEALKKTDGTKGSGAEVVVLGTGKAVEKTLKVASWFSEEKDCAVSIKTKTVGTVDDIVAGDEAEAEDESRVRKLSCLEITIKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.74
4 0.75
5 0.76
6 0.75
7 0.77
8 0.8
9 0.8
10 0.85
11 0.82
12 0.84
13 0.79
14 0.78
15 0.71
16 0.65
17 0.61
18 0.53
19 0.49
20 0.38
21 0.35
22 0.27
23 0.24
24 0.23
25 0.19
26 0.2
27 0.19
28 0.21
29 0.18
30 0.18
31 0.18
32 0.17
33 0.19
34 0.22
35 0.28
36 0.35
37 0.41
38 0.46
39 0.52
40 0.59
41 0.59
42 0.61
43 0.62
44 0.57
45 0.53
46 0.55
47 0.52
48 0.45
49 0.45
50 0.4
51 0.39
52 0.37
53 0.41
54 0.38
55 0.38
56 0.41
57 0.42
58 0.46
59 0.48
60 0.5
61 0.45
62 0.44
63 0.44
64 0.42
65 0.36
66 0.29
67 0.21
68 0.18
69 0.18
70 0.17
71 0.16
72 0.17
73 0.18
74 0.17
75 0.17
76 0.17
77 0.15
78 0.11
79 0.1
80 0.07
81 0.06
82 0.05
83 0.04
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.05
90 0.06
91 0.09
92 0.1
93 0.11
94 0.12
95 0.13
96 0.13
97 0.18
98 0.19
99 0.18
100 0.21
101 0.2
102 0.2
103 0.21
104 0.2
105 0.15
106 0.16
107 0.19
108 0.16
109 0.2
110 0.21
111 0.2
112 0.21
113 0.21
114 0.21
115 0.19
116 0.21
117 0.17
118 0.17
119 0.17
120 0.16
121 0.15
122 0.13
123 0.1
124 0.07
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.07
131 0.09
132 0.11
133 0.13
134 0.12
135 0.14
136 0.17
137 0.25
138 0.27
139 0.31
140 0.32