Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EAA4

Protein Details
Accession A7EAA4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
103-132TKELCAEILPKRKKRKKKVKETRRLKMSFIBasic
NLS Segment(s)
PositionSequence
112-128PKRKKRKKKVKETRRLK
Subcellular Location(s) cyto 15.5, cyto_nucl 13.5, nucl 10.5
Family & Domain DBs
KEGG ssl:SS1G_02236  -  
Amino Acid Sequences MATIIAIKAPVDNCTPPLEVPDAPASLSTPLLPAELAASPADGSLGAEGSEVASAEKNDATELEDMAGVSDIEVVEDGVSVVDDWGEFVLDIDVETGLAVEVTKELCAEILPKRKKRKKKVKETRRLKMSFIMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.2
4 0.22
5 0.23
6 0.19
7 0.21
8 0.22
9 0.19
10 0.18
11 0.18
12 0.16
13 0.13
14 0.13
15 0.1
16 0.08
17 0.08
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.08
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.05
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.04
56 0.03
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.02
66 0.02
67 0.03
68 0.02
69 0.02
70 0.02
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.08
96 0.15
97 0.25
98 0.35
99 0.44
100 0.55
101 0.65
102 0.76
103 0.84
104 0.89
105 0.9
106 0.92
107 0.95
108 0.95
109 0.96
110 0.96
111 0.95
112 0.95
113 0.86
114 0.78