Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084GEE7

Protein Details
Accession A0A084GEE7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
259-283AYAMGRRAERKKVREERQGKRQLMQHydrophilic
NLS Segment(s)
PositionSequence
264-278RRAERKKVREERQGK
Subcellular Location(s) mito 11.5, cyto_mito 9.5, cyto 6.5, pero 5, extr 3
Family & Domain DBs
KEGG sapo:SAPIO_CDS1487  -  
Amino Acid Sequences MKLTTLFAFFTPSLATAAVSVGHYHWDVVRAGTVDSFKWSSPFPGDGSPLTGYTTACEEKAIFNATQYRYTDLGEAPPAGVAPWAGTIRHLFTSRAYPGTWQGVNFKGDEREIVFMEYKDVPELARNWIEEQLKDPKMMAKRFMAVLGKRNAEGKVPPQAELDGLKVEDKLFMFAPAEIYDFLPLWVAKGAKGHKCEERLTDISKYVMQVDGDGILGWAQTLTRPDRDIGKRDVSFEIDARFVIESAEGRQVRQFWERAYAMGRRAERKKVREERQGKRQLMQAQRADKDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.09
5 0.1
6 0.09
7 0.09
8 0.08
9 0.11
10 0.11
11 0.11
12 0.11
13 0.13
14 0.13
15 0.13
16 0.15
17 0.14
18 0.14
19 0.15
20 0.16
21 0.14
22 0.18
23 0.18
24 0.16
25 0.17
26 0.18
27 0.18
28 0.2
29 0.22
30 0.2
31 0.21
32 0.23
33 0.22
34 0.25
35 0.23
36 0.2
37 0.19
38 0.18
39 0.15
40 0.13
41 0.17
42 0.15
43 0.13
44 0.14
45 0.13
46 0.13
47 0.16
48 0.18
49 0.14
50 0.15
51 0.22
52 0.23
53 0.27
54 0.27
55 0.28
56 0.26
57 0.27
58 0.27
59 0.2
60 0.2
61 0.17
62 0.16
63 0.13
64 0.11
65 0.11
66 0.08
67 0.08
68 0.05
69 0.04
70 0.06
71 0.07
72 0.07
73 0.08
74 0.1
75 0.12
76 0.14
77 0.15
78 0.14
79 0.15
80 0.2
81 0.21
82 0.22
83 0.2
84 0.19
85 0.2
86 0.24
87 0.23
88 0.19
89 0.2
90 0.21
91 0.22
92 0.21
93 0.19
94 0.16
95 0.16
96 0.16
97 0.14
98 0.13
99 0.12
100 0.13
101 0.13
102 0.11
103 0.14
104 0.13
105 0.12
106 0.11
107 0.1
108 0.09
109 0.1
110 0.11
111 0.12
112 0.13
113 0.13
114 0.14
115 0.19
116 0.2
117 0.18
118 0.2
119 0.24
120 0.24
121 0.23
122 0.22
123 0.22
124 0.27
125 0.28
126 0.28
127 0.21
128 0.22
129 0.22
130 0.24
131 0.23
132 0.19
133 0.23
134 0.24
135 0.23
136 0.23
137 0.24
138 0.22
139 0.2
140 0.2
141 0.16
142 0.21
143 0.21
144 0.21
145 0.2
146 0.2
147 0.19
148 0.18
149 0.17
150 0.09
151 0.09
152 0.08
153 0.08
154 0.08
155 0.09
156 0.08
157 0.08
158 0.08
159 0.08
160 0.09
161 0.08
162 0.09
163 0.08
164 0.09
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.07
173 0.08
174 0.08
175 0.08
176 0.13
177 0.18
178 0.22
179 0.26
180 0.29
181 0.32
182 0.36
183 0.37
184 0.36
185 0.37
186 0.35
187 0.35
188 0.34
189 0.3
190 0.28
191 0.26
192 0.24
193 0.18
194 0.16
195 0.13
196 0.11
197 0.1
198 0.09
199 0.08
200 0.08
201 0.07
202 0.05
203 0.05
204 0.04
205 0.04
206 0.03
207 0.05
208 0.09
209 0.11
210 0.14
211 0.15
212 0.17
213 0.26
214 0.32
215 0.36
216 0.38
217 0.43
218 0.42
219 0.44
220 0.45
221 0.39
222 0.36
223 0.32
224 0.28
225 0.2
226 0.19
227 0.17
228 0.15
229 0.12
230 0.1
231 0.09
232 0.09
233 0.1
234 0.19
235 0.18
236 0.19
237 0.22
238 0.23
239 0.26
240 0.31
241 0.31
242 0.24
243 0.32
244 0.31
245 0.31
246 0.33
247 0.33
248 0.32
249 0.36
250 0.4
251 0.41
252 0.46
253 0.55
254 0.6
255 0.63
256 0.7
257 0.73
258 0.78
259 0.8
260 0.85
261 0.84
262 0.86
263 0.89
264 0.82
265 0.75
266 0.73
267 0.71
268 0.7
269 0.69
270 0.66
271 0.65
272 0.65