Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F3Y5

Protein Details
Accession A7F3Y5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
82-105LQTALFMRNRRRERDKNKGIFVLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, cyto 4, cyto_pero 3.333
Family & Domain DBs
KEGG ssl:SS1G_11981  -  
Amino Acid Sequences MISEHRGMHVEQRKSFNEQRVLKKKVDYLTKLLEDLRETIINDQAINASARIELRQDLSDIQVGHIMSLISRSDLLDPIKSLQTALFMRNRRRERDKNKGIFVLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.58
4 0.59
5 0.6
6 0.65
7 0.68
8 0.7
9 0.65
10 0.63
11 0.6
12 0.57
13 0.57
14 0.5
15 0.46
16 0.47
17 0.45
18 0.42
19 0.37
20 0.32
21 0.24
22 0.22
23 0.19
24 0.14
25 0.14
26 0.14
27 0.16
28 0.15
29 0.13
30 0.12
31 0.1
32 0.09
33 0.09
34 0.08
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.06
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.11
47 0.11
48 0.1
49 0.11
50 0.11
51 0.1
52 0.1
53 0.09
54 0.06
55 0.07
56 0.07
57 0.05
58 0.06
59 0.07
60 0.07
61 0.1
62 0.12
63 0.12
64 0.13
65 0.15
66 0.16
67 0.15
68 0.15
69 0.12
70 0.16
71 0.17
72 0.2
73 0.25
74 0.31
75 0.4
76 0.5
77 0.56
78 0.59
79 0.68
80 0.74
81 0.77
82 0.82
83 0.84
84 0.83
85 0.84