Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084GE75

Protein Details
Accession A0A084GE75   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MKDHTKSRRGCFQCKKRKVKRRREHCSYLDQFGBasic
NLS Segment(s)
PositionSequence
15-23KKRKVKRRR
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Gene Ontology GO:0016020  C:membrane  
KEGG sapo:SAPIO_CDS1999  -  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MKDHTKSRRGCFQCKKRKVKRRREHCSYLDQFGSAESSPCSCPARHPVGRRSDIGAPRRSLEPLCYGMDLELTHFYLTHTYKTLWVRQEARLLWRDIIFLDAIMYPPLLSGILAVAAMHKILTCGDPDSAYKSIALRKQTAALEGFVPLLNSVTKETAEIVYSFSLLVSYWAFASLRLPLELSILSTTVDLELSQDANYSLPTGSILTQFLELLKRVRPTHAVLNETRPLVLTGKLSPMSKVPEDGELPGLDEDTKSALSALDRHIHPLPRCLSEYHASIPLLKMDTMHRIALKPEWGELIVAWPIRLANGFIEEVKLRNHVALTILAYWAVAFHTLEDRWWAKGWGISLISEISSIVTGPWAELLEWPRRRVGLDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.92
4 0.95
5 0.95
6 0.95
7 0.95
8 0.95
9 0.95
10 0.94
11 0.92
12 0.88
13 0.88
14 0.81
15 0.76
16 0.66
17 0.56
18 0.46
19 0.36
20 0.33
21 0.22
22 0.18
23 0.13
24 0.14
25 0.15
26 0.18
27 0.2
28 0.17
29 0.23
30 0.3
31 0.39
32 0.44
33 0.51
34 0.57
35 0.64
36 0.68
37 0.65
38 0.61
39 0.59
40 0.6
41 0.6
42 0.58
43 0.5
44 0.48
45 0.48
46 0.45
47 0.38
48 0.33
49 0.3
50 0.27
51 0.26
52 0.24
53 0.22
54 0.2
55 0.2
56 0.17
57 0.14
58 0.12
59 0.11
60 0.1
61 0.1
62 0.1
63 0.15
64 0.16
65 0.17
66 0.17
67 0.17
68 0.24
69 0.28
70 0.34
71 0.32
72 0.38
73 0.4
74 0.41
75 0.47
76 0.43
77 0.45
78 0.43
79 0.41
80 0.37
81 0.33
82 0.3
83 0.23
84 0.22
85 0.16
86 0.11
87 0.1
88 0.08
89 0.08
90 0.07
91 0.07
92 0.06
93 0.05
94 0.06
95 0.05
96 0.04
97 0.04
98 0.03
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.06
110 0.06
111 0.07
112 0.08
113 0.09
114 0.1
115 0.14
116 0.14
117 0.14
118 0.14
119 0.14
120 0.19
121 0.22
122 0.25
123 0.23
124 0.23
125 0.27
126 0.27
127 0.28
128 0.23
129 0.2
130 0.17
131 0.15
132 0.15
133 0.1
134 0.1
135 0.07
136 0.07
137 0.06
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.08
145 0.09
146 0.08
147 0.08
148 0.08
149 0.08
150 0.07
151 0.06
152 0.06
153 0.05
154 0.06
155 0.05
156 0.05
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.08
164 0.07
165 0.08
166 0.07
167 0.08
168 0.08
169 0.08
170 0.06
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.05
177 0.04
178 0.04
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.05
190 0.05
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.08
199 0.08
200 0.09
201 0.11
202 0.15
203 0.16
204 0.18
205 0.2
206 0.22
207 0.29
208 0.31
209 0.32
210 0.3
211 0.34
212 0.35
213 0.32
214 0.29
215 0.21
216 0.19
217 0.16
218 0.16
219 0.12
220 0.11
221 0.14
222 0.16
223 0.16
224 0.15
225 0.16
226 0.19
227 0.18
228 0.18
229 0.16
230 0.17
231 0.18
232 0.18
233 0.17
234 0.13
235 0.14
236 0.12
237 0.11
238 0.08
239 0.07
240 0.07
241 0.07
242 0.07
243 0.05
244 0.06
245 0.06
246 0.07
247 0.09
248 0.12
249 0.17
250 0.17
251 0.21
252 0.24
253 0.3
254 0.3
255 0.35
256 0.35
257 0.33
258 0.34
259 0.31
260 0.32
261 0.3
262 0.31
263 0.27
264 0.27
265 0.24
266 0.23
267 0.23
268 0.21
269 0.19
270 0.16
271 0.15
272 0.13
273 0.19
274 0.2
275 0.22
276 0.21
277 0.21
278 0.23
279 0.24
280 0.26
281 0.21
282 0.2
283 0.19
284 0.18
285 0.17
286 0.15
287 0.14
288 0.13
289 0.13
290 0.11
291 0.1
292 0.1
293 0.1
294 0.11
295 0.09
296 0.07
297 0.1
298 0.11
299 0.11
300 0.13
301 0.14
302 0.15
303 0.15
304 0.17
305 0.15
306 0.15
307 0.15
308 0.14
309 0.14
310 0.15
311 0.15
312 0.14
313 0.13
314 0.12
315 0.11
316 0.1
317 0.09
318 0.07
319 0.07
320 0.06
321 0.07
322 0.11
323 0.11
324 0.12
325 0.18
326 0.19
327 0.2
328 0.22
329 0.22
330 0.19
331 0.22
332 0.22
333 0.21
334 0.21
335 0.19
336 0.19
337 0.18
338 0.17
339 0.15
340 0.13
341 0.09
342 0.08
343 0.07
344 0.06
345 0.07
346 0.07
347 0.07
348 0.08
349 0.09
350 0.09
351 0.13
352 0.18
353 0.27
354 0.32
355 0.34
356 0.36
357 0.36
358 0.37