Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A084GH17

Protein Details
Accession A0A084GH17    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-24ANPNIKSKLRQSNRAAKLRKHydrophilic
58-78GPRAPISAKKRRKLERKLGYABasic
NLS Segment(s)
PositionSequence
12-82KLRQSNRAAKLRKIAQKRSAAAKHGADRVSKADTKRGARPGLLPTSGPRAPISAKKRRKLERKLGYAAKRR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
KEGG sapo:SAPIO_CDS0454  -  
Amino Acid Sequences MVNVANPNIKSKLRQSNRAAKLRKIAQKRSAAAKHGADRVSKADTKRGARPGLLPTSGPRAPISAKKRRKLERKLGYAAKRRMEAEGEVDMKGEGEKEEEMEVEGQIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.67
4 0.75
5 0.8
6 0.76
7 0.7
8 0.71
9 0.7
10 0.7
11 0.69
12 0.68
13 0.67
14 0.7
15 0.69
16 0.7
17 0.65
18 0.6
19 0.56
20 0.52
21 0.48
22 0.44
23 0.43
24 0.34
25 0.31
26 0.3
27 0.28
28 0.27
29 0.24
30 0.25
31 0.29
32 0.32
33 0.36
34 0.39
35 0.36
36 0.34
37 0.36
38 0.34
39 0.31
40 0.28
41 0.22
42 0.18
43 0.23
44 0.22
45 0.2
46 0.16
47 0.15
48 0.16
49 0.24
50 0.31
51 0.36
52 0.44
53 0.51
54 0.59
55 0.68
56 0.76
57 0.78
58 0.81
59 0.8
60 0.79
61 0.8
62 0.8
63 0.79
64 0.78
65 0.75
66 0.68
67 0.61
68 0.54
69 0.48
70 0.42
71 0.35
72 0.29
73 0.27
74 0.25
75 0.21
76 0.21
77 0.19
78 0.16
79 0.15
80 0.12
81 0.07
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.11
88 0.11