Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F026

Protein Details
Accession A7F026    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
181-200SARFRVKKKQREQALEQSAKHydrophilic
NLS Segment(s)
PositionSequence
174-189RRRNTAASARFRVKKK
Subcellular Location(s) nucl 22, cyto_nucl 15, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG ssl:SS1G_10943  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MAYNGRRGPNVSEYIANLNAIPTPQDLQNSNQESFNVDDDLAMFTNAQFFDFDLNQNTTTDLQAPNFDGVGAQSTADSVDMDLKDLDFGITADFNFSDFNTYPTNFGSHDGMPPVIHPIQTNHQIYQPPSSAGSPTSALVSPRVGEKRKAESVSDGRSPDFEDASRLAAEEDKRRRNTAASARFRVKKKQREQALEQSAKAMSDKVAALEGRINQLETENKWLKNLITEKNESKEDIAALWKKYNKDAGDRKGAERKDGVGTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.28
4 0.22
5 0.18
6 0.16
7 0.14
8 0.13
9 0.11
10 0.12
11 0.14
12 0.17
13 0.19
14 0.22
15 0.31
16 0.35
17 0.34
18 0.33
19 0.31
20 0.3
21 0.3
22 0.28
23 0.2
24 0.15
25 0.13
26 0.13
27 0.15
28 0.12
29 0.11
30 0.09
31 0.07
32 0.11
33 0.11
34 0.11
35 0.09
36 0.09
37 0.12
38 0.13
39 0.15
40 0.16
41 0.18
42 0.18
43 0.18
44 0.19
45 0.17
46 0.16
47 0.17
48 0.15
49 0.14
50 0.15
51 0.16
52 0.15
53 0.14
54 0.13
55 0.1
56 0.08
57 0.1
58 0.09
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.04
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.08
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.05
81 0.06
82 0.06
83 0.06
84 0.09
85 0.09
86 0.12
87 0.13
88 0.14
89 0.15
90 0.15
91 0.16
92 0.13
93 0.14
94 0.15
95 0.13
96 0.13
97 0.13
98 0.13
99 0.11
100 0.11
101 0.13
102 0.11
103 0.11
104 0.1
105 0.12
106 0.16
107 0.23
108 0.24
109 0.21
110 0.23
111 0.25
112 0.26
113 0.27
114 0.23
115 0.17
116 0.17
117 0.16
118 0.14
119 0.12
120 0.12
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.09
128 0.08
129 0.12
130 0.16
131 0.17
132 0.2
133 0.24
134 0.29
135 0.33
136 0.35
137 0.31
138 0.33
139 0.36
140 0.36
141 0.36
142 0.31
143 0.26
144 0.25
145 0.26
146 0.2
147 0.17
148 0.12
149 0.11
150 0.11
151 0.12
152 0.11
153 0.1
154 0.1
155 0.12
156 0.14
157 0.21
158 0.28
159 0.35
160 0.38
161 0.39
162 0.4
163 0.4
164 0.45
165 0.47
166 0.49
167 0.49
168 0.53
169 0.58
170 0.63
171 0.64
172 0.67
173 0.67
174 0.67
175 0.68
176 0.72
177 0.74
178 0.76
179 0.8
180 0.8
181 0.8
182 0.73
183 0.63
184 0.56
185 0.46
186 0.39
187 0.31
188 0.21
189 0.11
190 0.11
191 0.11
192 0.09
193 0.12
194 0.11
195 0.12
196 0.14
197 0.15
198 0.16
199 0.17
200 0.17
201 0.14
202 0.17
203 0.2
204 0.19
205 0.27
206 0.29
207 0.29
208 0.29
209 0.31
210 0.29
211 0.33
212 0.38
213 0.37
214 0.38
215 0.44
216 0.48
217 0.51
218 0.52
219 0.45
220 0.4
221 0.34
222 0.28
223 0.23
224 0.26
225 0.26
226 0.27
227 0.33
228 0.36
229 0.36
230 0.4
231 0.46
232 0.42
233 0.47
234 0.54
235 0.55
236 0.62
237 0.63
238 0.65
239 0.66
240 0.64
241 0.59
242 0.52
243 0.47
244 0.44