FuNGI

A0A084G9U3

Protein Details

Accession

A0A084G9U3

Localization Confidence

High

Confidence Score

17.5

NoLS Segment(s)

Position	Sequence	Protein Nature
337-361	GLPIKDYKKKGAKRTTRRAIMRPTF	Hydrophilic

NLS Segment(s)

Position	Sequence
243-248	LRRISR
344-355	KKKGAKRTTRRA
430-500	RAGRKRTAKALEEDHAEAAKEAKAKDKEEGKVRKVARKVNELAHANFKRLKLRNYGAKGGPGHNSRFRRRR

Subcellular Location(s)

nucl 22, cyto_nucl 14, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR021110 DNA_rep_checkpnt_protein IPR040203 Sld2
Gene Ontology	GO:0005634 C:nucleus GO:0007049 P:cell cycle GO:0006270 P:DNA replication initiation
KEGG	sapo:SAPIO_CDS3871 -
Pfam	View protein in Pfam PF11719 Drc1-Sld2
CDD	cd22289 RecQL4_SLD2_NTD

Amino Acid Sequences

MDAARKAALESQCQSLRASLKEWEHQWSASHGGSKPSRDAIKANPDIAKKYKEYNKLRDILSGKAKDESTSTKRKSAPEPAQTPVKRSKYVNLTDTRQKEDVPPVASTPSHDRFAPSPVAPTSIGPTPHRDGKVLGLFAFLDNGAVTPSKKDNEENRTMLLETPSRANEIEDFKLGRTPTSSSRRQYLDLLVTPLKATDGNARAAQTTPQSVSKLQFGTPSFLRRKTLPVVEETEEYESPKKLRRISRKPFARGLSAIVANLRKVEESQFEDDEAAMRELEAETFAPREILFAKPTKPASDPVVPDSQAGKKTKKLLGGFDDEAEYDSPVEEQTDRGLPIKDYKKKGAKRTTRRAIMRPTFIRRPAEETVYHEDEVTDEEDAAVPETQFDPTAVPDELEDISDGGSEFAPDPAPEANEASGVDNLVKAIRAGRKRTAKALEEDHAEAAKEAKAKDKEEGKVRKVARKVNELAHANFKRLKLRNYGAKGGPGHNSRFRRRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.35
3	0.37
4	0.33
5	0.33
6	0.33
7	0.35
8	0.41
9	0.43
10	0.44
11	0.42
12	0.4
13	0.39
14	0.36
15	0.35
16	0.3
17	0.33
18	0.28
19	0.34
20	0.37
21	0.39
22	0.39
23	0.41
24	0.42
25	0.39
26	0.42
27	0.42
28	0.48
29	0.48
30	0.49
31	0.48
32	0.48
33	0.51
34	0.53
35	0.51
36	0.43
37	0.48
38	0.52
39	0.57
40	0.64
41	0.67
42	0.71
43	0.71
44	0.69
45	0.67
46	0.61
47	0.58
48	0.58
49	0.52
50	0.44
51	0.43
52	0.42
53	0.35
54	0.36
55	0.38
56	0.36
57	0.42
58	0.44
59	0.48
60	0.52
61	0.57
62	0.6
63	0.63
64	0.65
65	0.64
66	0.65
67	0.62
68	0.67
69	0.63
70	0.62
71	0.61
72	0.57
73	0.51
74	0.5
75	0.53
76	0.52
77	0.58
78	0.6
79	0.56
80	0.57
81	0.61
82	0.63
83	0.6
84	0.52
85	0.46
86	0.43
87	0.44
88	0.43
89	0.37
90	0.34
91	0.3
92	0.31
93	0.3
94	0.29
95	0.29
96	0.28
97	0.27
98	0.26
99	0.27
100	0.26
101	0.3
102	0.32
103	0.24
104	0.24
105	0.23
106	0.26
107	0.23
108	0.22
109	0.21
110	0.2
111	0.23
112	0.2
113	0.25
114	0.27
115	0.33
116	0.34
117	0.32
118	0.29
119	0.32
120	0.35
121	0.31
122	0.26
123	0.21
124	0.2
125	0.19
126	0.18
127	0.11
128	0.07
129	0.06
130	0.06
131	0.05
132	0.06
133	0.06
134	0.09
135	0.12
136	0.14
137	0.16
138	0.22
139	0.3
140	0.37
141	0.43
142	0.42
143	0.41
144	0.4
145	0.39
146	0.34
147	0.29
148	0.23
149	0.17
150	0.18
151	0.17
152	0.17
153	0.16
154	0.15
155	0.16
156	0.18
157	0.19
158	0.18
159	0.18
160	0.17
161	0.21
162	0.2
163	0.17
164	0.14
165	0.16
166	0.22
167	0.29
168	0.35
169	0.35
170	0.4
171	0.42
172	0.42
173	0.42
174	0.37
175	0.33
176	0.28
177	0.29
178	0.24
179	0.22
180	0.2
181	0.18
182	0.15
183	0.1
184	0.1
185	0.13
186	0.14
187	0.16
188	0.17
189	0.18
190	0.18
191	0.18
192	0.19
193	0.14
194	0.13
195	0.13
196	0.13
197	0.15
198	0.16
199	0.16
200	0.18
201	0.18
202	0.17
203	0.2
204	0.19
205	0.21
206	0.21
207	0.27
208	0.27
209	0.28
210	0.3
211	0.26
212	0.3
213	0.3
214	0.32
215	0.26
216	0.26
217	0.28
218	0.27
219	0.27
220	0.24
221	0.22
222	0.18
223	0.18
224	0.17
225	0.14
226	0.14
227	0.19
228	0.22
229	0.26
230	0.35
231	0.44
232	0.54
233	0.62
234	0.71
235	0.73
236	0.74
237	0.74
238	0.67
239	0.59
240	0.49
241	0.42
242	0.34
243	0.26
244	0.21
245	0.17
246	0.15
247	0.12
248	0.12
249	0.1
250	0.07
251	0.08
252	0.09
253	0.1
254	0.14
255	0.16
256	0.16
257	0.16
258	0.16
259	0.16
260	0.15
261	0.13
262	0.1
263	0.07
264	0.06
265	0.06
266	0.06
267	0.06
268	0.06
269	0.05
270	0.05
271	0.05
272	0.06
273	0.06
274	0.05
275	0.06
276	0.07
277	0.09
278	0.11
279	0.13
280	0.15
281	0.19
282	0.2
283	0.22
284	0.22
285	0.23
286	0.25
287	0.28
288	0.28
289	0.27
290	0.29
291	0.28
292	0.27
293	0.27
294	0.25
295	0.26
296	0.28
297	0.27
298	0.28
299	0.34
300	0.37
301	0.41
302	0.4
303	0.39
304	0.39
305	0.43
306	0.39
307	0.33
308	0.31
309	0.24
310	0.23
311	0.18
312	0.13
313	0.07
314	0.07
315	0.06
316	0.06
317	0.07
318	0.06
319	0.06
320	0.08
321	0.1
322	0.1
323	0.12
324	0.13
325	0.13
326	0.22
327	0.31
328	0.37
329	0.4
330	0.48
331	0.56
332	0.62
333	0.71
334	0.73
335	0.75
336	0.78
337	0.84
338	0.85
339	0.85
340	0.84
341	0.81
342	0.8
343	0.76
344	0.74
345	0.7
346	0.68
347	0.65
348	0.64
349	0.62
350	0.53
351	0.53
352	0.47
353	0.44
354	0.39
355	0.37
356	0.39
357	0.38
358	0.37
359	0.3
360	0.27
361	0.23
362	0.23
363	0.19
364	0.11
365	0.07
366	0.07
367	0.08
368	0.08
369	0.09
370	0.08
371	0.07
372	0.08
373	0.09
374	0.09
375	0.09
376	0.09
377	0.08
378	0.09
379	0.12
380	0.11
381	0.1
382	0.1
383	0.12
384	0.11
385	0.11
386	0.1
387	0.07
388	0.07
389	0.07
390	0.07
391	0.06
392	0.06
393	0.06
394	0.06
395	0.07
396	0.08
397	0.07
398	0.09
399	0.1
400	0.11
401	0.11
402	0.12
403	0.12
404	0.12
405	0.13
406	0.13
407	0.12
408	0.11
409	0.1
410	0.09
411	0.09
412	0.09
413	0.08
414	0.07
415	0.13
416	0.2
417	0.27
418	0.33
419	0.42
420	0.51
421	0.54
422	0.62
423	0.64
424	0.62
425	0.61
426	0.62
427	0.57
428	0.51
429	0.5
430	0.43
431	0.36
432	0.31
433	0.25
434	0.2
435	0.18
436	0.18
437	0.17
438	0.24
439	0.28
440	0.3
441	0.38
442	0.44
443	0.48
444	0.55
445	0.64
446	0.59
447	0.63
448	0.67
449	0.67
450	0.67
451	0.69
452	0.66
453	0.66
454	0.67
455	0.65
456	0.68
457	0.65
458	0.61
459	0.63
460	0.57
461	0.53
462	0.52
463	0.49
464	0.5
465	0.51
466	0.54
467	0.52
468	0.6
469	0.65
470	0.67
471	0.71
472	0.64
473	0.65
474	0.63
475	0.57
476	0.57
477	0.52
478	0.53
479	0.54
480	0.6

A0A084G9U3

3D AlphaFold-predicted Structure Viewer