Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084G2J1

Protein Details
Accession A0A084G2J1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRQRMRLRAVDQVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sapo:SAPIO_CDS7719  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRMTSPLSGGLLWKIPWRLSKFQKRRQRMRLRAVDQVVATLDAALAKKGETLEALERWKAEMPTEAEMLPRDKYTMFDRKVKGYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.17
6 0.19
7 0.26
8 0.31
9 0.38
10 0.47
11 0.57
12 0.64
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.89
20 0.89
21 0.89
22 0.83
23 0.8
24 0.71
25 0.62
26 0.5
27 0.41
28 0.31
29 0.21
30 0.16
31 0.09
32 0.07
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.08
44 0.1
45 0.12
46 0.11
47 0.12
48 0.12
49 0.14
50 0.13
51 0.11
52 0.13
53 0.14
54 0.16
55 0.17
56 0.16
57 0.15
58 0.16
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.36
69 0.38
70 0.46
71 0.54
72 0.59
73 0.61
74 0.61
75 0.65
76 0.67
77 0.73
78 0.73
79 0.76
80 0.75
81 0.77
82 0.77
83 0.79
84 0.76
85 0.76
86 0.78
87 0.78
88 0.8
89 0.77
90 0.79