Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C6A7

Protein Details
Accession Q6C6A7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-153HNYWKQKGVKGNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNKNGNRSNLNVHydrophilic
NLS Segment(s)
PositionSequence
107-146QKGVKGNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNKNG
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
KEGG yli:YALI0E11055g  -  
Amino Acid Sequences MVKERRTMADTNRHSRGMERMVVCKWLLYHNSCDTVEARLLNYAALRRSLTTIYRGAQVRSTCTRQTSGCTTSVRTSTVLISTELVPTCMKSLNYYRDEQKHNYWKQKGVKGNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNKNGNRSNLNVVKRILVVDSARCKVTSTSATVNLGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.49
4 0.44
5 0.42
6 0.37
7 0.37
8 0.36
9 0.39
10 0.36
11 0.3
12 0.25
13 0.24
14 0.27
15 0.26
16 0.3
17 0.31
18 0.35
19 0.34
20 0.35
21 0.29
22 0.27
23 0.25
24 0.2
25 0.17
26 0.15
27 0.15
28 0.13
29 0.14
30 0.14
31 0.13
32 0.14
33 0.14
34 0.13
35 0.15
36 0.17
37 0.17
38 0.18
39 0.19
40 0.19
41 0.24
42 0.24
43 0.23
44 0.26
45 0.25
46 0.26
47 0.29
48 0.32
49 0.28
50 0.29
51 0.3
52 0.27
53 0.3
54 0.3
55 0.28
56 0.28
57 0.27
58 0.27
59 0.27
60 0.27
61 0.24
62 0.19
63 0.17
64 0.14
65 0.14
66 0.13
67 0.11
68 0.11
69 0.1
70 0.11
71 0.1
72 0.1
73 0.09
74 0.08
75 0.08
76 0.09
77 0.09
78 0.1
79 0.15
80 0.2
81 0.23
82 0.26
83 0.3
84 0.34
85 0.39
86 0.4
87 0.43
88 0.47
89 0.51
90 0.58
91 0.56
92 0.57
93 0.6
94 0.64
95 0.64
96 0.64
97 0.67
98 0.68
99 0.76
100 0.76
101 0.8
102 0.81
103 0.83
104 0.85
105 0.86
106 0.86
107 0.86
108 0.9
109 0.9
110 0.93
111 0.93
112 0.93
113 0.94
114 0.94
115 0.94
116 0.94
117 0.94
118 0.94
119 0.94
120 0.94
121 0.94
122 0.94
123 0.94
124 0.94
125 0.94
126 0.94
127 0.94
128 0.93
129 0.93
130 0.92
131 0.92
132 0.91
133 0.89
134 0.83
135 0.76
136 0.76
137 0.72
138 0.66
139 0.59
140 0.51
141 0.43
142 0.39
143 0.34
144 0.26
145 0.22
146 0.21
147 0.23
148 0.29
149 0.29
150 0.3
151 0.29
152 0.3
153 0.28
154 0.32
155 0.28
156 0.27
157 0.31
158 0.34