FuNGI

A0A084QQW2

Protein Details

Accession

A0A084QQW2

Localization Confidence

Medium

Confidence Score

10.7

NoLS Segment(s)

Position	Sequence	Protein Nature
462-490	GVDVSERRGEWRRRRWVRLVKRRAELHTT	Hydrophilic

NLS Segment(s)

Position	Sequence
470-484	GEWRRRRWVRLVKRR

Subcellular Location(s)

cyto_nucl 10, nucl 9.5, cyto 7.5, mito 6, plas 2

Family & Domain DBs

InterPro	View protein in InterPro IPR010482 Peroxin
Gene Ontology	GO:0005778 C:peroxisomal membrane GO:0007031 P:peroxisome organization
Pfam	View protein in Pfam PF06398 Pex24p

Amino Acid Sequences

MDDFTAEILASRQDEDNRAFSSPEQQRPLVPEPDPEVDPEPPATPSQHMGGLRGGLAAIREKANIQDRLVEKLLERVIPADDNVGTDAPILTDEKASAFAQRPNFNITTMSNNFRRFNARIGAVFMFQDEVIRVLSWQRPSHTMSLLAVYTFVCLDPYLVCVLPIAILILGVLIPAFIARHPAPPKLTWASEQNVSYSPRGPPLAPAATVRPAKEMSRDFFRNMRDLQNSMEDFSVGHDKIIALLVPLTNFSNEALSSAVFQFLSVGGLFMTVASHHLPWRFIFLAIGWAAIWAGHPSVARLLAATQQQHLQALEKEAKSWLDNWTATDVILDSAPETREVEIFELQRMSNAGEWEPWFFSPSPYDPLSQPRIAGERPRGTRFFEDVMPPDGWEWSEKKWALDLWSREWVEERIITGVEVETEGERWVYDIYVEKGDRTGLTDPLDRENLRSRPTLPSWEEGVDVSERRGEWRRRRWVRLVKRRAELHTT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.26
3	0.29
4	0.29
5	0.29
6	0.29
7	0.26
8	0.34
9	0.38
10	0.42
11	0.44
12	0.43
13	0.44
14	0.5
15	0.56
16	0.51
17	0.43
18	0.4
19	0.4
20	0.43
21	0.4
22	0.36
23	0.34
24	0.29
25	0.3
26	0.27
27	0.23
28	0.2
29	0.22
30	0.21
31	0.2
32	0.21
33	0.21
34	0.24
35	0.23
36	0.24
37	0.23
38	0.22
39	0.2
40	0.17
41	0.15
42	0.1
43	0.11
44	0.12
45	0.12
46	0.13
47	0.13
48	0.14
49	0.2
50	0.27
51	0.3
52	0.28
53	0.33
54	0.33
55	0.39
56	0.39
57	0.34
58	0.27
59	0.29
60	0.31
61	0.24
62	0.23
63	0.18
64	0.18
65	0.18
66	0.18
67	0.15
68	0.12
69	0.12
70	0.14
71	0.12
72	0.1
73	0.1
74	0.09
75	0.07
76	0.08
77	0.08
78	0.08
79	0.08
80	0.08
81	0.09
82	0.11
83	0.11
84	0.15
85	0.17
86	0.21
87	0.27
88	0.3
89	0.32
90	0.35
91	0.35
92	0.32
93	0.31
94	0.27
95	0.29
96	0.29
97	0.34
98	0.33
99	0.38
100	0.39
101	0.38
102	0.43
103	0.37
104	0.38
105	0.38
106	0.34
107	0.3
108	0.33
109	0.32
110	0.26
111	0.24
112	0.19
113	0.15
114	0.12
115	0.11
116	0.08
117	0.07
118	0.07
119	0.07
120	0.07
121	0.1
122	0.14
123	0.19
124	0.21
125	0.22
126	0.25
127	0.29
128	0.32
129	0.3
130	0.27
131	0.22
132	0.22
133	0.2
134	0.16
135	0.13
136	0.1
137	0.09
138	0.08
139	0.07
140	0.05
141	0.05
142	0.06
143	0.05
144	0.06
145	0.08
146	0.07
147	0.07
148	0.07
149	0.07
150	0.06
151	0.06
152	0.05
153	0.03
154	0.03
155	0.03
156	0.03
157	0.03
158	0.02
159	0.02
160	0.02
161	0.02
162	0.02
163	0.02
164	0.02
165	0.07
166	0.08
167	0.15
168	0.17
169	0.21
170	0.23
171	0.24
172	0.3
173	0.29
174	0.29
175	0.25
176	0.27
177	0.27
178	0.28
179	0.28
180	0.24
181	0.23
182	0.24
183	0.23
184	0.21
185	0.19
186	0.18
187	0.19
188	0.17
189	0.16
190	0.19
191	0.19
192	0.18
193	0.18
194	0.17
195	0.22
196	0.23
197	0.22
198	0.19
199	0.19
200	0.19
201	0.23
202	0.24
203	0.21
204	0.27
205	0.29
206	0.28
207	0.31
208	0.32
209	0.31
210	0.3
211	0.32
212	0.27
213	0.26
214	0.25
215	0.26
216	0.25
217	0.22
218	0.19
219	0.14
220	0.12
221	0.13
222	0.15
223	0.1
224	0.1
225	0.09
226	0.09
227	0.09
228	0.09
229	0.08
230	0.04
231	0.04
232	0.05
233	0.04
234	0.05
235	0.05
236	0.05
237	0.05
238	0.05
239	0.06
240	0.05
241	0.06
242	0.05
243	0.05
244	0.06
245	0.06
246	0.07
247	0.06
248	0.06
249	0.05
250	0.05
251	0.06
252	0.04
253	0.04
254	0.04
255	0.04
256	0.04
257	0.03
258	0.03
259	0.03
260	0.04
261	0.05
262	0.06
263	0.08
264	0.09
265	0.1
266	0.1
267	0.14
268	0.14
269	0.13
270	0.13
271	0.11
272	0.13
273	0.12
274	0.12
275	0.07
276	0.07
277	0.06
278	0.06
279	0.06
280	0.04
281	0.04
282	0.05
283	0.05
284	0.05
285	0.06
286	0.07
287	0.06
288	0.06
289	0.07
290	0.09
291	0.12
292	0.13
293	0.13
294	0.15
295	0.15
296	0.16
297	0.16
298	0.14
299	0.12
300	0.16
301	0.2
302	0.18
303	0.19
304	0.19
305	0.2
306	0.18
307	0.19
308	0.18
309	0.17
310	0.18
311	0.18
312	0.19
313	0.18
314	0.17
315	0.16
316	0.13
317	0.09
318	0.08
319	0.07
320	0.05
321	0.07
322	0.07
323	0.08
324	0.09
325	0.09
326	0.09
327	0.1
328	0.12
329	0.14
330	0.14
331	0.15
332	0.15
333	0.14
334	0.14
335	0.14
336	0.13
337	0.12
338	0.13
339	0.12
340	0.13
341	0.14
342	0.15
343	0.16
344	0.15
345	0.16
346	0.15
347	0.16
348	0.17
349	0.19
350	0.22
351	0.22
352	0.23
353	0.22
354	0.29
355	0.33
356	0.3
357	0.28
358	0.26
359	0.29
360	0.29
361	0.34
362	0.36
363	0.38
364	0.43
365	0.48
366	0.47
367	0.48
368	0.5
369	0.47
370	0.41
371	0.36
372	0.34
373	0.32
374	0.34
375	0.29
376	0.25
377	0.22
378	0.2
379	0.17
380	0.17
381	0.16
382	0.15
383	0.23
384	0.24
385	0.24
386	0.26
387	0.27
388	0.29
389	0.35
390	0.36
391	0.32
392	0.4
393	0.4
394	0.38
395	0.38
396	0.34
397	0.3
398	0.27
399	0.23
400	0.16
401	0.16
402	0.15
403	0.13
404	0.12
405	0.09
406	0.08
407	0.08
408	0.07
409	0.08
410	0.08
411	0.08
412	0.07
413	0.08
414	0.08
415	0.07
416	0.08
417	0.12
418	0.14
419	0.2
420	0.21
421	0.21
422	0.21
423	0.22
424	0.21
425	0.21
426	0.21
427	0.18
428	0.21
429	0.26
430	0.27
431	0.31
432	0.36
433	0.32
434	0.34
435	0.4
436	0.41
437	0.4
438	0.42
439	0.39
440	0.42
441	0.45
442	0.5
443	0.45
444	0.44
445	0.44
446	0.42
447	0.4
448	0.32
449	0.31
450	0.25
451	0.22
452	0.19
453	0.19
454	0.18
455	0.23
456	0.32
457	0.4
458	0.47
459	0.57
460	0.67
461	0.73
462	0.82
463	0.87
464	0.89
465	0.9
466	0.91
467	0.91
468	0.89
469	0.88
470	0.86

A0A084QQW2

3D AlphaFold-predicted Structure Viewer