Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A084QQW2

Protein Details
Accession A0A084QQW2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
462-490GVDVSERRGEWRRRRWVRLVKRRAELHTTHydrophilic
NLS Segment(s)
PositionSequence
470-484GEWRRRRWVRLVKRR
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 7.5, mito 6, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences MDDFTAEILASRQDEDNRAFSSPEQQRPLVPEPDPEVDPEPPATPSQHMGGLRGGLAAIREKANIQDRLVEKLLERVIPADDNVGTDAPILTDEKASAFAQRPNFNITTMSNNFRRFNARIGAVFMFQDEVIRVLSWQRPSHTMSLLAVYTFVCLDPYLVCVLPIAILILGVLIPAFIARHPAPPKLTWASEQNVSYSPRGPPLAPAATVRPAKEMSRDFFRNMRDLQNSMEDFSVGHDKIIALLVPLTNFSNEALSSAVFQFLSVGGLFMTVASHHLPWRFIFLAIGWAAIWAGHPSVARLLAATQQQHLQALEKEAKSWLDNWTATDVILDSAPETREVEIFELQRMSNAGEWEPWFFSPSPYDPLSQPRIAGERPRGTRFFEDVMPPDGWEWSEKKWALDLWSREWVEERIITGVEVETEGERWVYDIYVEKGDRTGLTDPLDRENLRSRPTLPSWEEGVDVSERRGEWRRRRWVRLVKRRAELHTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.29
5 0.29
6 0.29
7 0.26
8 0.34
9 0.38
10 0.42
11 0.44
12 0.43
13 0.44
14 0.5
15 0.56
16 0.51
17 0.43
18 0.4
19 0.4
20 0.43
21 0.4
22 0.36
23 0.34
24 0.29
25 0.3
26 0.27
27 0.23
28 0.2
29 0.22
30 0.21
31 0.2
32 0.21
33 0.21
34 0.24
35 0.23
36 0.24
37 0.23
38 0.22
39 0.2
40 0.17
41 0.15
42 0.1
43 0.11
44 0.12
45 0.12
46 0.13
47 0.13
48 0.14
49 0.2
50 0.27
51 0.3
52 0.28
53 0.33
54 0.33
55 0.39
56 0.39
57 0.34
58 0.27
59 0.29
60 0.31
61 0.24
62 0.23
63 0.18
64 0.18
65 0.18
66 0.18
67 0.15
68 0.12
69 0.12
70 0.14
71 0.12
72 0.1
73 0.1
74 0.09
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.09
82 0.11
83 0.11
84 0.15
85 0.17
86 0.21
87 0.27
88 0.3
89 0.32
90 0.35
91 0.35
92 0.32
93 0.31
94 0.27
95 0.29
96 0.29
97 0.34
98 0.33
99 0.38
100 0.39
101 0.38
102 0.43
103 0.37
104 0.38
105 0.38
106 0.34
107 0.3
108 0.33
109 0.32
110 0.26
111 0.24
112 0.19
113 0.15
114 0.12
115 0.11
116 0.08
117 0.07
118 0.07
119 0.07
120 0.07
121 0.1
122 0.14
123 0.19
124 0.21
125 0.22
126 0.25
127 0.29
128 0.32
129 0.3
130 0.27
131 0.22
132 0.22
133 0.2
134 0.16
135 0.13
136 0.1
137 0.09
138 0.08
139 0.07
140 0.05
141 0.05
142 0.06
143 0.05
144 0.06
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.05
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.07
166 0.08
167 0.15
168 0.17
169 0.21
170 0.23
171 0.24
172 0.3
173 0.29
174 0.29
175 0.25
176 0.27
177 0.27
178 0.28
179 0.28
180 0.24
181 0.23
182 0.24
183 0.23
184 0.21
185 0.19
186 0.18
187 0.19
188 0.17
189 0.16
190 0.19
191 0.19
192 0.18
193 0.18
194 0.17
195 0.22
196 0.23
197 0.22
198 0.19
199 0.19
200 0.19
201 0.23
202 0.24
203 0.21
204 0.27
205 0.29
206 0.28
207 0.31
208 0.32
209 0.31
210 0.3
211 0.32
212 0.27
213 0.26
214 0.25
215 0.26
216 0.25
217 0.22
218 0.19
219 0.14
220 0.12
221 0.13
222 0.15
223 0.1
224 0.1
225 0.09
226 0.09
227 0.09
228 0.09
229 0.08
230 0.04
231 0.04
232 0.05
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.06
240 0.05
241 0.06
242 0.05
243 0.05
244 0.06
245 0.06
246 0.07
247 0.06
248 0.06
249 0.05
250 0.05
251 0.06
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.03
258 0.03
259 0.03
260 0.04
261 0.05
262 0.06
263 0.08
264 0.09
265 0.1
266 0.1
267 0.14
268 0.14
269 0.13
270 0.13
271 0.11
272 0.13
273 0.12
274 0.12
275 0.07
276 0.07
277 0.06
278 0.06
279 0.06
280 0.04
281 0.04
282 0.05
283 0.05
284 0.05
285 0.06
286 0.07
287 0.06
288 0.06
289 0.07
290 0.09
291 0.12
292 0.13
293 0.13
294 0.15
295 0.15
296 0.16
297 0.16
298 0.14
299 0.12
300 0.16
301 0.2
302 0.18
303 0.19
304 0.19
305 0.2
306 0.18
307 0.19
308 0.18
309 0.17
310 0.18
311 0.18
312 0.19
313 0.18
314 0.17
315 0.16
316 0.13
317 0.09
318 0.08
319 0.07
320 0.05
321 0.07
322 0.07
323 0.08
324 0.09
325 0.09
326 0.09
327 0.1
328 0.12
329 0.14
330 0.14
331 0.15
332 0.15
333 0.14
334 0.14
335 0.14
336 0.13
337 0.12
338 0.13
339 0.12
340 0.13
341 0.14
342 0.15
343 0.16
344 0.15
345 0.16
346 0.15
347 0.16
348 0.17
349 0.19
350 0.22
351 0.22
352 0.23
353 0.22
354 0.29
355 0.33
356 0.3
357 0.28
358 0.26
359 0.29
360 0.29
361 0.34
362 0.36
363 0.38
364 0.43
365 0.48
366 0.47
367 0.48
368 0.5
369 0.47
370 0.41
371 0.36
372 0.34
373 0.32
374 0.34
375 0.29
376 0.25
377 0.22
378 0.2
379 0.17
380 0.17
381 0.16
382 0.15
383 0.23
384 0.24
385 0.24
386 0.26
387 0.27
388 0.29
389 0.35
390 0.36
391 0.32
392 0.4
393 0.4
394 0.38
395 0.38
396 0.34
397 0.3
398 0.27
399 0.23
400 0.16
401 0.16
402 0.15
403 0.13
404 0.12
405 0.09
406 0.08
407 0.08
408 0.07
409 0.08
410 0.08
411 0.08
412 0.07
413 0.08
414 0.08
415 0.07
416 0.08
417 0.12
418 0.14
419 0.2
420 0.21
421 0.21
422 0.21
423 0.22
424 0.21
425 0.21
426 0.21
427 0.18
428 0.21
429 0.26
430 0.27
431 0.31
432 0.36
433 0.32
434 0.34
435 0.4
436 0.41
437 0.4
438 0.42
439 0.39
440 0.42
441 0.45
442 0.5
443 0.45
444 0.44
445 0.44
446 0.42
447 0.4
448 0.32
449 0.31
450 0.25
451 0.22
452 0.19
453 0.19
454 0.18
455 0.23
456 0.32
457 0.4
458 0.47
459 0.57
460 0.67
461 0.73
462 0.82
463 0.87
464 0.89
465 0.9
466 0.91
467 0.91
468 0.89
469 0.88
470 0.86