Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072P1P5

Protein Details
Accession A0A072P1P5   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNNETYRPRNTRPRRQSAATTRTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MNNETYRPRNTRPRRQSAATTRTTPRSDKHARDLELNRRAATKCRNKQKIFVENLQKRCRTEEERLHEQKTLVHALLNEVIDLKNEVMRHSLCGCQSLRTAILPPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.82
4 0.81
5 0.79
6 0.73
7 0.68
8 0.63
9 0.62
10 0.6
11 0.53
12 0.45
13 0.46
14 0.49
15 0.49
16 0.53
17 0.54
18 0.52
19 0.57
20 0.61
21 0.61
22 0.6
23 0.56
24 0.48
25 0.43
26 0.43
27 0.4
28 0.43
29 0.44
30 0.45
31 0.55
32 0.64
33 0.62
34 0.69
35 0.72
36 0.71
37 0.65
38 0.64
39 0.63
40 0.6
41 0.67
42 0.64
43 0.58
44 0.5
45 0.48
46 0.47
47 0.42
48 0.43
49 0.44
50 0.47
51 0.54
52 0.58
53 0.56
54 0.52
55 0.47
56 0.41
57 0.36
58 0.3
59 0.2
60 0.17
61 0.16
62 0.16
63 0.19
64 0.16
65 0.13
66 0.11
67 0.11
68 0.1
69 0.11
70 0.1
71 0.09
72 0.1
73 0.11
74 0.14
75 0.14
76 0.17
77 0.18
78 0.22
79 0.2
80 0.25
81 0.25
82 0.24
83 0.25
84 0.25
85 0.25
86 0.23
87 0.25