Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072P2C1

Protein Details
Accession A0A072P2C1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-76DKADKIKQSLPPKINKKNKKAKKABasic
NLS Segment(s)
PositionSequence
16-76RRKDATGARIKKSAKGKDIKLKLRGKRFLYTLKLKDSDKADKIKQSLPPKINKKNKKAKKA
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFLEIARRKDATGARIKKSAKGKDIKLKLRGKRFLYTLKLKDSDKADKIKQSLPPKINKKNKKAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.35
4 0.34
5 0.39
6 0.4
7 0.38
8 0.43
9 0.45
10 0.42
11 0.47
12 0.48
13 0.49
14 0.55
15 0.53
16 0.51
17 0.52
18 0.54
19 0.57
20 0.65
21 0.65
22 0.66
23 0.68
24 0.66
25 0.68
26 0.69
27 0.63
28 0.57
29 0.54
30 0.51
31 0.5
32 0.52
33 0.47
34 0.46
35 0.46
36 0.43
37 0.44
38 0.43
39 0.43
40 0.4
41 0.43
42 0.42
43 0.44
44 0.47
45 0.47
46 0.5
47 0.52
48 0.56
49 0.56
50 0.63
51 0.67
52 0.75
53 0.8
54 0.83
55 0.85
56 0.87