Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CDB6

Protein Details
Accession Q6CDB6    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-25CGSLLPCQVRQKRPRLAQCMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
KEGG yli:YALI0C01947g  -  
Amino Acid Sequences MLAQRCGSLLPCQVRQKRPRLAQCMSAVLQRQRKTLIYQSGVLVSRRKLTGAASFAIDRTDSAHRPDGERPTFSPNRPWFSHQGTAGSDFKAQSEDERLWKSTKQFCREYSVSFVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.72
4 0.74
5 0.79
6 0.81
7 0.79
8 0.74
9 0.72
10 0.66
11 0.62
12 0.53
13 0.47
14 0.42
15 0.41
16 0.44
17 0.39
18 0.38
19 0.35
20 0.36
21 0.36
22 0.39
23 0.39
24 0.34
25 0.33
26 0.32
27 0.33
28 0.33
29 0.3
30 0.25
31 0.19
32 0.19
33 0.18
34 0.17
35 0.15
36 0.15
37 0.17
38 0.17
39 0.16
40 0.15
41 0.15
42 0.14
43 0.14
44 0.12
45 0.08
46 0.09
47 0.11
48 0.11
49 0.14
50 0.18
51 0.19
52 0.21
53 0.25
54 0.31
55 0.3
56 0.31
57 0.3
58 0.34
59 0.38
60 0.36
61 0.42
62 0.4
63 0.43
64 0.44
65 0.47
66 0.44
67 0.46
68 0.49
69 0.41
70 0.38
71 0.34
72 0.36
73 0.33
74 0.28
75 0.24
76 0.19
77 0.18
78 0.17
79 0.15
80 0.13
81 0.17
82 0.19
83 0.23
84 0.26
85 0.28
86 0.3
87 0.33
88 0.38
89 0.43
90 0.5
91 0.51
92 0.54
93 0.55
94 0.61
95 0.6
96 0.56