Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072P9Q0

Protein Details
Accession A0A072P9Q0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRQPRKLKWTKTSRAMRGKEMHydrophilic
NLS Segment(s)
PositionSequence
63-85ARRERVYTRRRLSGKAQREAKRR
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0005840  C:ribosome  
Amino Acid Sequences MKRQPRKLKWTKTSRAMRGKEMIVDQNLLLSQFAKRRNAPVKYDRNLVAATMKAMERIEEIRARRERVYTRRRLSGKAQREAKRRQNLKVVAEGEHLIRKELADLEAARAEMEPMAEKVKMEMEASRVMGEERLRLKSKRKLLVGGGTEEEMDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.81
4 0.77
5 0.72
6 0.64
7 0.57
8 0.51
9 0.46
10 0.37
11 0.34
12 0.27
13 0.23
14 0.21
15 0.18
16 0.14
17 0.1
18 0.11
19 0.15
20 0.2
21 0.25
22 0.26
23 0.35
24 0.44
25 0.48
26 0.53
27 0.58
28 0.62
29 0.61
30 0.64
31 0.56
32 0.5
33 0.44
34 0.37
35 0.29
36 0.19
37 0.16
38 0.13
39 0.11
40 0.1
41 0.1
42 0.1
43 0.09
44 0.1
45 0.13
46 0.15
47 0.17
48 0.23
49 0.27
50 0.29
51 0.29
52 0.33
53 0.37
54 0.43
55 0.52
56 0.53
57 0.54
58 0.59
59 0.6
60 0.59
61 0.6
62 0.6
63 0.58
64 0.57
65 0.62
66 0.6
67 0.66
68 0.71
69 0.72
70 0.72
71 0.68
72 0.64
73 0.64
74 0.62
75 0.56
76 0.54
77 0.46
78 0.37
79 0.34
80 0.31
81 0.23
82 0.21
83 0.19
84 0.13
85 0.12
86 0.11
87 0.1
88 0.1
89 0.1
90 0.09
91 0.1
92 0.11
93 0.11
94 0.12
95 0.11
96 0.1
97 0.09
98 0.07
99 0.07
100 0.07
101 0.07
102 0.09
103 0.09
104 0.09
105 0.09
106 0.11
107 0.12
108 0.11
109 0.12
110 0.13
111 0.15
112 0.16
113 0.15
114 0.14
115 0.13
116 0.16
117 0.15
118 0.18
119 0.2
120 0.25
121 0.3
122 0.34
123 0.42
124 0.49
125 0.57
126 0.6
127 0.6
128 0.6
129 0.61
130 0.66
131 0.6
132 0.55
133 0.48
134 0.39
135 0.35