Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PMZ4

Protein Details
Accession A0A072PMZ4   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-59SSATHTPPVAHKKKTKSPKTLTNFHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 9.5, cyto_nucl 8.833, cyto_mito 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002052  DNA_methylase_N6_adenine_CS  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003676  F:nucleic acid binding  
GO:0043414  P:macromolecule methylation  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
PROSITE View protein in PROSITE  
PS00092  N6_MTASE  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MRYCRDLPSARNELRWLKEHARDLAATRVLRNCSSATHTPPVAHKKKTKSPKTLTNFHDVEAIQNKILSRLVWQRSRGKPLQYILGTQPFGDLEIKCHEGVLIPRPETETYTEQIGKILSDRILDVKNDLANKICQRKRIRILDLCTGTGCIALLLHSLLKPPPGTMAPSSVLSKTELGIEVVGLDISDRAVELARLNLKHNVEKRLLHPDARKDIHFATRDIREIDVVPGKTSLETVARGDRETRVYLNPELENQSLIDGSWDVVISNPPYISSKELTGPGSVEKSVRKYEPRLALVPPDDDDCGPQDRSSPDLFYRLLVKVTRKVDASLLVMEVGDSEQANRILRLAHRELSHGANEALFESWRDNGSVRQNNHLGGLGHDPEKRTVASEEGISDRVVVYWRGDWARWRRDTSTPPIAKNNQPAMCGPEKIKIDASRQGITPLANQATH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.54
4 0.51
5 0.56
6 0.58
7 0.57
8 0.53
9 0.49
10 0.47
11 0.47
12 0.46
13 0.39
14 0.37
15 0.38
16 0.38
17 0.37
18 0.37
19 0.3
20 0.27
21 0.33
22 0.35
23 0.36
24 0.38
25 0.39
26 0.39
27 0.47
28 0.55
29 0.55
30 0.58
31 0.6
32 0.63
33 0.72
34 0.8
35 0.82
36 0.82
37 0.83
38 0.85
39 0.85
40 0.85
41 0.79
42 0.78
43 0.68
44 0.58
45 0.54
46 0.43
47 0.41
48 0.37
49 0.34
50 0.25
51 0.25
52 0.25
53 0.21
54 0.23
55 0.17
56 0.17
57 0.25
58 0.32
59 0.37
60 0.43
61 0.51
62 0.57
63 0.66
64 0.65
65 0.62
66 0.6
67 0.57
68 0.59
69 0.51
70 0.48
71 0.44
72 0.45
73 0.39
74 0.33
75 0.31
76 0.22
77 0.22
78 0.21
79 0.16
80 0.13
81 0.17
82 0.19
83 0.18
84 0.18
85 0.17
86 0.16
87 0.19
88 0.24
89 0.26
90 0.24
91 0.25
92 0.28
93 0.28
94 0.28
95 0.3
96 0.24
97 0.2
98 0.25
99 0.25
100 0.23
101 0.23
102 0.21
103 0.16
104 0.15
105 0.16
106 0.11
107 0.11
108 0.12
109 0.14
110 0.15
111 0.15
112 0.15
113 0.15
114 0.17
115 0.18
116 0.18
117 0.17
118 0.2
119 0.27
120 0.36
121 0.36
122 0.42
123 0.47
124 0.55
125 0.63
126 0.66
127 0.68
128 0.65
129 0.67
130 0.67
131 0.63
132 0.54
133 0.45
134 0.36
135 0.28
136 0.21
137 0.16
138 0.07
139 0.05
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.07
146 0.07
147 0.09
148 0.09
149 0.09
150 0.11
151 0.11
152 0.13
153 0.13
154 0.16
155 0.15
156 0.17
157 0.18
158 0.16
159 0.16
160 0.15
161 0.14
162 0.11
163 0.11
164 0.1
165 0.09
166 0.08
167 0.07
168 0.06
169 0.05
170 0.05
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.02
177 0.03
178 0.03
179 0.04
180 0.04
181 0.07
182 0.1
183 0.11
184 0.13
185 0.18
186 0.19
187 0.25
188 0.28
189 0.3
190 0.3
191 0.31
192 0.32
193 0.37
194 0.37
195 0.36
196 0.36
197 0.38
198 0.42
199 0.42
200 0.39
201 0.33
202 0.33
203 0.34
204 0.32
205 0.27
206 0.23
207 0.23
208 0.24
209 0.23
210 0.21
211 0.15
212 0.14
213 0.15
214 0.16
215 0.14
216 0.13
217 0.13
218 0.12
219 0.12
220 0.11
221 0.1
222 0.07
223 0.08
224 0.09
225 0.11
226 0.12
227 0.12
228 0.14
229 0.14
230 0.15
231 0.16
232 0.16
233 0.15
234 0.18
235 0.19
236 0.2
237 0.19
238 0.18
239 0.2
240 0.18
241 0.17
242 0.14
243 0.13
244 0.1
245 0.09
246 0.08
247 0.05
248 0.05
249 0.05
250 0.05
251 0.04
252 0.05
253 0.06
254 0.06
255 0.07
256 0.07
257 0.07
258 0.09
259 0.1
260 0.12
261 0.12
262 0.13
263 0.14
264 0.17
265 0.17
266 0.16
267 0.16
268 0.14
269 0.15
270 0.14
271 0.14
272 0.14
273 0.17
274 0.2
275 0.23
276 0.26
277 0.29
278 0.36
279 0.41
280 0.42
281 0.41
282 0.39
283 0.39
284 0.36
285 0.33
286 0.27
287 0.21
288 0.18
289 0.16
290 0.16
291 0.13
292 0.15
293 0.14
294 0.14
295 0.16
296 0.16
297 0.19
298 0.19
299 0.2
300 0.18
301 0.21
302 0.21
303 0.19
304 0.21
305 0.19
306 0.2
307 0.21
308 0.24
309 0.27
310 0.29
311 0.31
312 0.28
313 0.29
314 0.27
315 0.27
316 0.25
317 0.18
318 0.16
319 0.13
320 0.12
321 0.11
322 0.09
323 0.07
324 0.06
325 0.05
326 0.05
327 0.07
328 0.1
329 0.11
330 0.11
331 0.11
332 0.13
333 0.15
334 0.22
335 0.24
336 0.26
337 0.26
338 0.29
339 0.31
340 0.31
341 0.3
342 0.25
343 0.21
344 0.17
345 0.16
346 0.14
347 0.13
348 0.1
349 0.09
350 0.09
351 0.1
352 0.11
353 0.12
354 0.12
355 0.16
356 0.26
357 0.34
358 0.34
359 0.4
360 0.41
361 0.41
362 0.41
363 0.39
364 0.29
365 0.23
366 0.26
367 0.22
368 0.24
369 0.25
370 0.25
371 0.24
372 0.26
373 0.24
374 0.22
375 0.21
376 0.2
377 0.2
378 0.19
379 0.2
380 0.2
381 0.21
382 0.18
383 0.17
384 0.14
385 0.13
386 0.13
387 0.12
388 0.12
389 0.13
390 0.18
391 0.2
392 0.21
393 0.29
394 0.37
395 0.46
396 0.5
397 0.54
398 0.53
399 0.59
400 0.65
401 0.65
402 0.66
403 0.62
404 0.61
405 0.65
406 0.67
407 0.66
408 0.68
409 0.68
410 0.6
411 0.56
412 0.53
413 0.51
414 0.49
415 0.45
416 0.38
417 0.36
418 0.36
419 0.37
420 0.42
421 0.4
422 0.41
423 0.45
424 0.48
425 0.44
426 0.42
427 0.42
428 0.37
429 0.33
430 0.31
431 0.31