Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072NY39

Protein Details
Accession A0A072NY39    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
143-162DVNARVWNPRRQKRAGLCKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025110  AMP-bd_C  
IPR045851  AMP-bd_C_sf  
Pfam View protein in Pfam  
PF13193  AMP-binding_C  
Amino Acid Sequences MPLDSWQDVPDGSVGKASMEVELKIAGLVDEGEGELSVQNFCLHIERQILGLPYVNEAMVVGVPDNEFGQRVAAVVTLRKDSSSTSTRPNLDGLRQDLRSGLAGYKLPTLLRVVEGELLKNATGKLVKKVLGPLYFPENDQQDVNARVWNPRRQKRAGLCKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.12
5 0.13
6 0.12
7 0.12
8 0.11
9 0.12
10 0.11
11 0.1
12 0.09
13 0.06
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.09
30 0.09
31 0.11
32 0.14
33 0.14
34 0.14
35 0.16
36 0.16
37 0.14
38 0.15
39 0.12
40 0.11
41 0.11
42 0.1
43 0.08
44 0.07
45 0.07
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.13
70 0.16
71 0.17
72 0.21
73 0.25
74 0.26
75 0.27
76 0.28
77 0.25
78 0.24
79 0.25
80 0.24
81 0.24
82 0.23
83 0.22
84 0.2
85 0.19
86 0.18
87 0.15
88 0.12
89 0.1
90 0.1
91 0.11
92 0.12
93 0.12
94 0.11
95 0.11
96 0.12
97 0.1
98 0.1
99 0.1
100 0.1
101 0.13
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.12
108 0.11
109 0.1
110 0.13
111 0.14
112 0.19
113 0.22
114 0.24
115 0.25
116 0.3
117 0.34
118 0.33
119 0.33
120 0.3
121 0.32
122 0.32
123 0.31
124 0.3
125 0.26
126 0.26
127 0.24
128 0.23
129 0.22
130 0.24
131 0.24
132 0.22
133 0.21
134 0.28
135 0.35
136 0.42
137 0.49
138 0.55
139 0.63
140 0.65
141 0.74
142 0.76