Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PL21

Protein Details
Accession A0A072PL21    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
184-207FMKIEGCKKRKRHCYIGKKKPIGEBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007051  CHORD_dom  
IPR007052  CS_dom  
IPR008978  HSP20-like_chaperone  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF04968  CHORD  
PF04969  CS  
PROSITE View protein in PROSITE  
PS51401  CHORD  
PS51203  CS  
CDD cd06466  p23_CS_SGT1_like  
Amino Acid Sequences MAQKCVHKGCGKVFNDPEEECIYHPGPPEFHEGQKGWKCCKPRVLTFDEFLAIPPCTTGRHSTVDDTPAPPPKPAPEDVPNSSAAPVYAPLPVTKPLASSLSAAQQPTPSSTPKPEPPPDESDDPDAEIPNGSSCKRRGCGKSQDAKISRDNEECIYHPGIPIFHEGSKGWTCCKRRVLEFDEFMKIEGCKKRKRHCYIGKKKPIGEGADTGSKAEEKLETVRNDFYQTPTTVIVSFYLKKIDKGQTKIEFSHDGATIALDLPTSDGKRFTSTLPLFAPIDPEKSSFKIMGTKLEMTLVKKDGASWSTLRNDEQPTGSRIQLGQAGRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.51
4 0.46
5 0.41
6 0.39
7 0.31
8 0.33
9 0.28
10 0.25
11 0.28
12 0.27
13 0.24
14 0.26
15 0.33
16 0.3
17 0.32
18 0.36
19 0.33
20 0.4
21 0.47
22 0.5
23 0.48
24 0.5
25 0.53
26 0.53
27 0.62
28 0.6
29 0.61
30 0.63
31 0.66
32 0.65
33 0.61
34 0.56
35 0.48
36 0.4
37 0.32
38 0.27
39 0.18
40 0.14
41 0.12
42 0.11
43 0.12
44 0.14
45 0.18
46 0.19
47 0.23
48 0.26
49 0.29
50 0.32
51 0.34
52 0.34
53 0.32
54 0.32
55 0.35
56 0.34
57 0.31
58 0.3
59 0.3
60 0.32
61 0.32
62 0.34
63 0.33
64 0.39
65 0.41
66 0.42
67 0.39
68 0.35
69 0.33
70 0.26
71 0.19
72 0.13
73 0.11
74 0.09
75 0.09
76 0.09
77 0.09
78 0.11
79 0.13
80 0.14
81 0.14
82 0.14
83 0.14
84 0.15
85 0.16
86 0.15
87 0.14
88 0.17
89 0.19
90 0.18
91 0.17
92 0.17
93 0.16
94 0.18
95 0.19
96 0.17
97 0.18
98 0.23
99 0.27
100 0.32
101 0.39
102 0.41
103 0.43
104 0.46
105 0.49
106 0.49
107 0.47
108 0.43
109 0.38
110 0.33
111 0.3
112 0.25
113 0.2
114 0.15
115 0.12
116 0.1
117 0.08
118 0.1
119 0.09
120 0.13
121 0.15
122 0.19
123 0.22
124 0.29
125 0.32
126 0.39
127 0.48
128 0.54
129 0.61
130 0.6
131 0.67
132 0.63
133 0.61
134 0.58
135 0.51
136 0.45
137 0.37
138 0.35
139 0.28
140 0.26
141 0.23
142 0.22
143 0.2
144 0.17
145 0.15
146 0.14
147 0.13
148 0.12
149 0.13
150 0.11
151 0.1
152 0.11
153 0.11
154 0.14
155 0.16
156 0.16
157 0.17
158 0.22
159 0.25
160 0.3
161 0.36
162 0.35
163 0.36
164 0.43
165 0.46
166 0.45
167 0.46
168 0.43
169 0.39
170 0.36
171 0.32
172 0.26
173 0.21
174 0.2
175 0.24
176 0.27
177 0.32
178 0.41
179 0.5
180 0.6
181 0.67
182 0.72
183 0.76
184 0.82
185 0.85
186 0.88
187 0.89
188 0.84
189 0.78
190 0.71
191 0.65
192 0.56
193 0.47
194 0.38
195 0.31
196 0.3
197 0.28
198 0.23
199 0.19
200 0.16
201 0.14
202 0.12
203 0.1
204 0.08
205 0.12
206 0.18
207 0.19
208 0.21
209 0.23
210 0.23
211 0.26
212 0.25
213 0.24
214 0.22
215 0.21
216 0.2
217 0.19
218 0.19
219 0.16
220 0.16
221 0.15
222 0.14
223 0.15
224 0.14
225 0.2
226 0.19
227 0.21
228 0.27
229 0.34
230 0.38
231 0.41
232 0.49
233 0.5
234 0.53
235 0.53
236 0.5
237 0.45
238 0.39
239 0.38
240 0.3
241 0.23
242 0.19
243 0.18
244 0.14
245 0.11
246 0.1
247 0.06
248 0.05
249 0.06
250 0.1
251 0.11
252 0.12
253 0.13
254 0.14
255 0.18
256 0.2
257 0.19
258 0.26
259 0.26
260 0.29
261 0.29
262 0.31
263 0.29
264 0.27
265 0.32
266 0.23
267 0.26
268 0.23
269 0.24
270 0.24
271 0.25
272 0.28
273 0.23
274 0.23
275 0.27
276 0.27
277 0.32
278 0.33
279 0.33
280 0.3
281 0.34
282 0.35
283 0.3
284 0.34
285 0.29
286 0.26
287 0.24
288 0.25
289 0.26
290 0.25
291 0.26
292 0.23
293 0.27
294 0.31
295 0.33
296 0.34
297 0.35
298 0.38
299 0.37
300 0.39
301 0.37
302 0.36
303 0.37
304 0.36
305 0.33
306 0.28
307 0.28
308 0.3
309 0.27