Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072PTS2

Protein Details
Accession A0A072PTS2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-41HGPCDACERGKKKKRKEQNRKAQRNHRLRSEBasic
NLS Segment(s)
PositionSequence
19-38RGKKKKRKEQNRKAQRNHRL
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences SNHGLRHHPHHGPCDACERGKKKKRKEQNRKAQRNHRLRSETKLDQLRTMVQSQTQEIAALKEVNCLLEKDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.4
4 0.43
5 0.44
6 0.49
7 0.57
8 0.64
9 0.67
10 0.74
11 0.82
12 0.85
13 0.91
14 0.91
15 0.92
16 0.94
17 0.94
18 0.93
19 0.93
20 0.91
21 0.9
22 0.83
23 0.8
24 0.75
25 0.67
26 0.63
27 0.6
28 0.53
29 0.5
30 0.52
31 0.45
32 0.4
33 0.39
34 0.36
35 0.31
36 0.3
37 0.24
38 0.2
39 0.2
40 0.2
41 0.2
42 0.17
43 0.15
44 0.14
45 0.14
46 0.14
47 0.15
48 0.14
49 0.16
50 0.16
51 0.17
52 0.17