Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CHK8

Protein Details
Accession Q6CHK8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-118SIKSPPPMPTKGKKGKKVKCCSEHydrophilic
NLS Segment(s)
PositionSequence
105-112TKGKKGKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0044183  F:protein folding chaperone  
GO:0045333  P:cellular respiration  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
KEGG yli:YALI0A07799g  -  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MSQGLTAYRNVLRAANLAFKNDHFVLGQAKANIRKGFEDGRKLDPKDEDVKVRLEHINGVAYVLRTQVVQGQKHNPDEEKYQLNLHKDSEMGDNESIKSPPPMPTKGKKGKKVKCCSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.25
4 0.25
5 0.26
6 0.25
7 0.29
8 0.27
9 0.25
10 0.17
11 0.18
12 0.18
13 0.19
14 0.22
15 0.18
16 0.21
17 0.24
18 0.3
19 0.3
20 0.28
21 0.27
22 0.28
23 0.33
24 0.34
25 0.38
26 0.35
27 0.42
28 0.47
29 0.46
30 0.46
31 0.39
32 0.39
33 0.36
34 0.36
35 0.31
36 0.26
37 0.28
38 0.25
39 0.27
40 0.24
41 0.19
42 0.17
43 0.15
44 0.14
45 0.11
46 0.11
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.1
55 0.14
56 0.16
57 0.19
58 0.26
59 0.3
60 0.32
61 0.34
62 0.31
63 0.29
64 0.31
65 0.31
66 0.29
67 0.25
68 0.28
69 0.3
70 0.32
71 0.31
72 0.29
73 0.26
74 0.22
75 0.23
76 0.22
77 0.2
78 0.2
79 0.19
80 0.19
81 0.2
82 0.21
83 0.2
84 0.17
85 0.17
86 0.16
87 0.23
88 0.28
89 0.33
90 0.39
91 0.48
92 0.58
93 0.66
94 0.74
95 0.76
96 0.81
97 0.84
98 0.87