Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CCA0

Protein Details
Accession Q6CCA0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
38-58KQEAPRKKPFWRVKRARGEGWBasic
NLS Segment(s)
PositionSequence
42-54PRKKPFWRVKRAR
Subcellular Location(s) cyto 10, cyto_nucl 9.5, mito 9, nucl 7
Family & Domain DBs
KEGG yli:YALI0C11209g  -  
Amino Acid Sequences MGILGFSRKNKTELSTNKPDEGQITDDTLYVKETETAKQEAPRKKPFWRVKRARGEGWTHYGGKAFEGGYIGAGGGGGYFGYSYDSGGGFGGGGDGGCGGDGGGGGDGGGSCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.56
4 0.56
5 0.54
6 0.5
7 0.42
8 0.36
9 0.31
10 0.22
11 0.2
12 0.18
13 0.18
14 0.18
15 0.16
16 0.14
17 0.11
18 0.1
19 0.11
20 0.12
21 0.14
22 0.17
23 0.19
24 0.2
25 0.25
26 0.33
27 0.37
28 0.43
29 0.5
30 0.51
31 0.54
32 0.63
33 0.67
34 0.69
35 0.73
36 0.75
37 0.76
38 0.82
39 0.81
40 0.74
41 0.68
42 0.63
43 0.54
44 0.5
45 0.42
46 0.32
47 0.28
48 0.26
49 0.21
50 0.17
51 0.15
52 0.1
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.05
59 0.04
60 0.04
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.04
69 0.04
70 0.05
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04