Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072P294

Protein Details
Accession A0A072P294    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-68SQLRSHPPRRGKKPASQPPQPRRGSHydrophilic
NLS Segment(s)
PositionSequence
49-66HPPRRGKKPASQPPQPRR
Subcellular Location(s) mito 18, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR034078  NFX1_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
CDD cd16492  RING-CH-C4HC3_NFX1-like  
Amino Acid Sequences IHPNRTMAGRQFGGQLTRLHAEAPAFVPASLPPPASTPPSSPGSQLRSHPPRRGKKPASQPPQPRRGSVSRSSAPDIVTRIHEDISHGVYECAICTNEIGRNSKVWSCRTCWTVFHIGCIKRWSKNEGSSVQRTAGQDEQDVPVGKQWRCPGCNLPKDTTPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.24
4 0.25
5 0.24
6 0.21
7 0.2
8 0.18
9 0.16
10 0.16
11 0.15
12 0.13
13 0.13
14 0.13
15 0.12
16 0.15
17 0.14
18 0.14
19 0.11
20 0.13
21 0.16
22 0.2
23 0.21
24 0.2
25 0.23
26 0.27
27 0.27
28 0.27
29 0.3
30 0.3
31 0.32
32 0.32
33 0.38
34 0.44
35 0.49
36 0.55
37 0.59
38 0.65
39 0.7
40 0.78
41 0.74
42 0.73
43 0.79
44 0.81
45 0.79
46 0.79
47 0.81
48 0.79
49 0.83
50 0.75
51 0.65
52 0.6
53 0.58
54 0.54
55 0.49
56 0.47
57 0.4
58 0.42
59 0.43
60 0.38
61 0.34
62 0.29
63 0.25
64 0.18
65 0.16
66 0.15
67 0.13
68 0.12
69 0.11
70 0.11
71 0.11
72 0.11
73 0.1
74 0.09
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.05
81 0.05
82 0.05
83 0.07
84 0.1
85 0.13
86 0.16
87 0.16
88 0.17
89 0.19
90 0.22
91 0.25
92 0.27
93 0.27
94 0.28
95 0.31
96 0.34
97 0.33
98 0.31
99 0.32
100 0.37
101 0.34
102 0.36
103 0.39
104 0.36
105 0.38
106 0.42
107 0.39
108 0.36
109 0.39
110 0.4
111 0.39
112 0.44
113 0.47
114 0.48
115 0.52
116 0.51
117 0.5
118 0.46
119 0.43
120 0.38
121 0.36
122 0.33
123 0.27
124 0.24
125 0.24
126 0.24
127 0.24
128 0.24
129 0.2
130 0.22
131 0.28
132 0.27
133 0.31
134 0.37
135 0.41
136 0.42
137 0.47
138 0.51
139 0.55
140 0.64
141 0.63
142 0.61
143 0.58