Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C721

Protein Details
Accession Q6C721    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
686-712AEKKAAMTARKQKAKEKKQFNPYEIKEHydrophilic
NLS Segment(s)
PositionSequence
688-738KKAAMTARKQKAKEKKQFNPYEIKEDAKGASKRRGPKDGGARSVQYKKRRT
Subcellular Location(s) nucl 15.5, cyto_nucl 13.833, cyto 10, mito_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002562  3'-5'_exonuclease_dom  
IPR012588  Exosome-assoc_fac_Rrp6_N  
IPR010997  HRDC-like_sf  
IPR002121  HRDC_dom  
IPR044876  HRDC_dom_sf  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
IPR045092  Rrp6-like  
Gene Ontology GO:0000176  C:nuclear exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0000166  F:nucleotide binding  
GO:0042134  F:rRNA primary transcript binding  
GO:0003727  F:single-stranded RNA binding  
GO:0000467  P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0071044  P:histone mRNA catabolic process  
GO:0071028  P:nuclear mRNA surveillance  
GO:0071040  P:nuclear polyadenylation-dependent antisense transcript catabolic process  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071042  P:nuclear polyadenylation-dependent mRNA catabolic process  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071036  P:nuclear polyadenylation-dependent snoRNA catabolic process  
GO:0071037  P:nuclear polyadenylation-dependent snRNA catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
GO:0071051  P:polyadenylation-dependent snoRNA 3'-end processing  
GO:0000973  P:post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery  
GO:0034473  P:U1 snRNA 3'-end processing  
GO:0034475  P:U4 snRNA 3'-end processing  
GO:0034476  P:U5 snRNA 3'-end processing  
KEGG yli:YALI0E04444g  -  
Pfam View protein in Pfam  
PF01612  DNA_pol_A_exo1  
PF00570  HRDC  
PF08066  PMC2NT  
PROSITE View protein in PROSITE  
PS50967  HRDC  
CDD cd06147  Rrp6p_like_exo  
Amino Acid Sequences MEIDSVVRLAQQTAKAARGLASHDIKFYSSIDDKVADSVKENASQLIGVVNQLAQKIAPNEVGSFPPELDTVNRHWNEFSSVVDDLYEKTDIQLGKLNKKGDKVEIAESKKTGPQTLGEKIRVGNAIQSSSEIKGPQWKPQEMWEVDNSRDTPFKPKLTSKPNALEPLEDAFELVTEDDRRDHYPQPYAKEIMEQPYPDEVYEETEVIPNRPWEAEGEDEYIYVDTEEKLRDMVDHLKTQEEIAIDVEHHSMRTYYGITCLVQVSSREQDYIIDTIALRNLEIFNEVLTDPKIVKVLHGATMDIQWLQRDFGLYIVSLFDTFHAAQALGLKGHSLAFLLQHYANFVTSKKYQLSDWRIRPMSPEQLLYARADTHFLLNIYDQLKNALVQKDKIEGVLEKSRQTASQRYEYTGYDPRYYLKSFDYEGGINRLISQFHITGPSVSVAKALFLWRDSMARKEDESTGYVMPNYLLVSLANRMPQTPEAVFSVSKSLPLLVRKNVEEILDVIKDSKDEHVEVEQVEEEPVLAAESIEGAEFSEIAEVIFLAAQDGQSDITGKFDSSKSSIVHVKETALGPLGVSKIDKHMMVLAVPVAPLSVDSTESDSEVQNAEEEVKVEQDAAADDESDYSEDEHEHANDIIIAKSNKKYTADKEAKKGVAKEKSEEFTPFDYSAGASILKSDDQKAAEKKAAMTARKQKAKEKKQFNPYEIKEDAKGASKRRGPKDGGARSVQYKKRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.28
5 0.25
6 0.27
7 0.29
8 0.32
9 0.31
10 0.31
11 0.32
12 0.3
13 0.3
14 0.27
15 0.26
16 0.22
17 0.23
18 0.23
19 0.24
20 0.23
21 0.26
22 0.28
23 0.21
24 0.21
25 0.24
26 0.25
27 0.27
28 0.27
29 0.24
30 0.21
31 0.21
32 0.19
33 0.15
34 0.13
35 0.1
36 0.1
37 0.1
38 0.11
39 0.11
40 0.12
41 0.1
42 0.13
43 0.15
44 0.17
45 0.18
46 0.17
47 0.19
48 0.21
49 0.22
50 0.21
51 0.2
52 0.17
53 0.16
54 0.15
55 0.14
56 0.15
57 0.17
58 0.2
59 0.29
60 0.3
61 0.3
62 0.3
63 0.3
64 0.33
65 0.3
66 0.27
67 0.2
68 0.2
69 0.19
70 0.19
71 0.17
72 0.14
73 0.15
74 0.15
75 0.11
76 0.11
77 0.16
78 0.15
79 0.16
80 0.22
81 0.25
82 0.32
83 0.37
84 0.43
85 0.41
86 0.46
87 0.48
88 0.46
89 0.48
90 0.44
91 0.47
92 0.5
93 0.52
94 0.5
95 0.48
96 0.45
97 0.42
98 0.4
99 0.33
100 0.26
101 0.26
102 0.29
103 0.36
104 0.41
105 0.39
106 0.39
107 0.38
108 0.4
109 0.36
110 0.3
111 0.26
112 0.22
113 0.21
114 0.19
115 0.21
116 0.19
117 0.19
118 0.21
119 0.17
120 0.16
121 0.24
122 0.26
123 0.32
124 0.38
125 0.4
126 0.39
127 0.44
128 0.53
129 0.45
130 0.47
131 0.46
132 0.41
133 0.4
134 0.43
135 0.38
136 0.3
137 0.31
138 0.28
139 0.29
140 0.32
141 0.36
142 0.38
143 0.44
144 0.52
145 0.58
146 0.63
147 0.62
148 0.63
149 0.64
150 0.65
151 0.57
152 0.49
153 0.42
154 0.38
155 0.31
156 0.24
157 0.18
158 0.11
159 0.11
160 0.1
161 0.08
162 0.07
163 0.07
164 0.08
165 0.1
166 0.13
167 0.16
168 0.2
169 0.25
170 0.27
171 0.34
172 0.38
173 0.42
174 0.44
175 0.42
176 0.39
177 0.38
178 0.37
179 0.33
180 0.31
181 0.26
182 0.24
183 0.25
184 0.25
185 0.2
186 0.19
187 0.14
188 0.15
189 0.16
190 0.15
191 0.12
192 0.15
193 0.15
194 0.15
195 0.17
196 0.14
197 0.14
198 0.14
199 0.14
200 0.12
201 0.14
202 0.16
203 0.16
204 0.17
205 0.16
206 0.16
207 0.16
208 0.14
209 0.12
210 0.09
211 0.08
212 0.05
213 0.07
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.11
220 0.17
221 0.19
222 0.22
223 0.22
224 0.23
225 0.24
226 0.23
227 0.22
228 0.15
229 0.12
230 0.1
231 0.1
232 0.09
233 0.09
234 0.11
235 0.09
236 0.08
237 0.08
238 0.07
239 0.07
240 0.09
241 0.09
242 0.08
243 0.1
244 0.11
245 0.11
246 0.12
247 0.12
248 0.11
249 0.11
250 0.11
251 0.13
252 0.14
253 0.14
254 0.14
255 0.13
256 0.14
257 0.15
258 0.15
259 0.11
260 0.09
261 0.08
262 0.09
263 0.1
264 0.09
265 0.07
266 0.07
267 0.07
268 0.07
269 0.08
270 0.07
271 0.05
272 0.07
273 0.07
274 0.07
275 0.08
276 0.08
277 0.07
278 0.08
279 0.11
280 0.09
281 0.09
282 0.12
283 0.13
284 0.16
285 0.16
286 0.16
287 0.14
288 0.14
289 0.15
290 0.11
291 0.1
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.06
301 0.06
302 0.06
303 0.06
304 0.05
305 0.05
306 0.05
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.07
313 0.09
314 0.1
315 0.07
316 0.07
317 0.06
318 0.06
319 0.07
320 0.06
321 0.04
322 0.04
323 0.05
324 0.05
325 0.07
326 0.07
327 0.07
328 0.08
329 0.08
330 0.08
331 0.08
332 0.08
333 0.11
334 0.11
335 0.15
336 0.15
337 0.16
338 0.17
339 0.25
340 0.33
341 0.38
342 0.4
343 0.45
344 0.44
345 0.43
346 0.45
347 0.4
348 0.38
349 0.3
350 0.27
351 0.21
352 0.22
353 0.23
354 0.2
355 0.17
356 0.11
357 0.1
358 0.1
359 0.09
360 0.09
361 0.08
362 0.08
363 0.08
364 0.07
365 0.11
366 0.11
367 0.11
368 0.1
369 0.11
370 0.11
371 0.11
372 0.15
373 0.15
374 0.15
375 0.16
376 0.17
377 0.19
378 0.19
379 0.18
380 0.15
381 0.12
382 0.15
383 0.2
384 0.2
385 0.18
386 0.2
387 0.2
388 0.21
389 0.23
390 0.25
391 0.23
392 0.3
393 0.3
394 0.31
395 0.33
396 0.31
397 0.32
398 0.33
399 0.31
400 0.25
401 0.24
402 0.23
403 0.25
404 0.25
405 0.22
406 0.17
407 0.17
408 0.16
409 0.17
410 0.17
411 0.15
412 0.15
413 0.17
414 0.16
415 0.13
416 0.13
417 0.13
418 0.11
419 0.11
420 0.12
421 0.1
422 0.09
423 0.12
424 0.11
425 0.11
426 0.11
427 0.12
428 0.1
429 0.09
430 0.1
431 0.07
432 0.07
433 0.08
434 0.08
435 0.08
436 0.08
437 0.1
438 0.09
439 0.13
440 0.13
441 0.16
442 0.18
443 0.19
444 0.19
445 0.2
446 0.21
447 0.2
448 0.2
449 0.19
450 0.17
451 0.16
452 0.15
453 0.13
454 0.11
455 0.09
456 0.08
457 0.06
458 0.05
459 0.05
460 0.06
461 0.07
462 0.08
463 0.1
464 0.1
465 0.1
466 0.12
467 0.13
468 0.15
469 0.14
470 0.15
471 0.14
472 0.15
473 0.15
474 0.14
475 0.17
476 0.14
477 0.14
478 0.12
479 0.12
480 0.14
481 0.19
482 0.23
483 0.23
484 0.26
485 0.26
486 0.29
487 0.28
488 0.26
489 0.21
490 0.19
491 0.17
492 0.14
493 0.14
494 0.12
495 0.11
496 0.11
497 0.11
498 0.12
499 0.11
500 0.11
501 0.13
502 0.13
503 0.15
504 0.15
505 0.15
506 0.13
507 0.11
508 0.11
509 0.09
510 0.07
511 0.06
512 0.06
513 0.05
514 0.04
515 0.03
516 0.03
517 0.04
518 0.04
519 0.03
520 0.03
521 0.03
522 0.03
523 0.04
524 0.04
525 0.04
526 0.04
527 0.04
528 0.04
529 0.03
530 0.03
531 0.04
532 0.04
533 0.04
534 0.04
535 0.04
536 0.04
537 0.05
538 0.05
539 0.05
540 0.07
541 0.06
542 0.08
543 0.09
544 0.09
545 0.11
546 0.12
547 0.15
548 0.16
549 0.2
550 0.18
551 0.22
552 0.27
553 0.26
554 0.29
555 0.27
556 0.26
557 0.25
558 0.25
559 0.22
560 0.18
561 0.16
562 0.12
563 0.13
564 0.13
565 0.1
566 0.1
567 0.1
568 0.12
569 0.14
570 0.14
571 0.13
572 0.15
573 0.15
574 0.15
575 0.15
576 0.12
577 0.1
578 0.1
579 0.09
580 0.06
581 0.05
582 0.05
583 0.06
584 0.06
585 0.07
586 0.08
587 0.11
588 0.12
589 0.13
590 0.14
591 0.12
592 0.13
593 0.12
594 0.12
595 0.09
596 0.09
597 0.1
598 0.09
599 0.1
600 0.09
601 0.09
602 0.09
603 0.09
604 0.09
605 0.08
606 0.08
607 0.09
608 0.09
609 0.08
610 0.08
611 0.09
612 0.09
613 0.09
614 0.09
615 0.08
616 0.08
617 0.08
618 0.1
619 0.12
620 0.11
621 0.13
622 0.13
623 0.12
624 0.13
625 0.14
626 0.13
627 0.16
628 0.18
629 0.2
630 0.25
631 0.28
632 0.31
633 0.34
634 0.39
635 0.4
636 0.5
637 0.56
638 0.57
639 0.62
640 0.66
641 0.66
642 0.65
643 0.66
644 0.64
645 0.63
646 0.6
647 0.57
648 0.56
649 0.54
650 0.51
651 0.48
652 0.42
653 0.36
654 0.37
655 0.32
656 0.26
657 0.23
658 0.2
659 0.18
660 0.15
661 0.13
662 0.08
663 0.09
664 0.11
665 0.13
666 0.15
667 0.16
668 0.19
669 0.21
670 0.29
671 0.33
672 0.37
673 0.39
674 0.39
675 0.38
676 0.42
677 0.47
678 0.43
679 0.48
680 0.53
681 0.59
682 0.65
683 0.68
684 0.7
685 0.74
686 0.81
687 0.81
688 0.82
689 0.81
690 0.84
691 0.89
692 0.86
693 0.85
694 0.79
695 0.76
696 0.68
697 0.62
698 0.53
699 0.46
700 0.42
701 0.41
702 0.42
703 0.4
704 0.46
705 0.5
706 0.58
707 0.63
708 0.69
709 0.66
710 0.7
711 0.75
712 0.74
713 0.74
714 0.69
715 0.66
716 0.65
717 0.7
718 0.69