FuNGI

A0A072PB71

Protein Details

Accession

A0A072PB71

Localization Confidence

Medium

Confidence Score

12.1

NoLS Segment(s)

Position	Sequence	Protein Nature
399-420	ALESEKKTTKKERKLAESKFSE	Hydrophilic

NLS Segment(s)

Position	Sequence
366-375	ARRLRRLKRR

Subcellular Location(s)

nucl 16, cyto_nucl 12, cyto 6, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR007900 TAF4_C
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0006352 P:DNA-templated transcription initiation
Pfam	View protein in Pfam PF05236 TAF4

Amino Acid Sequences

MSLGYSSPSPQQFSPQFSQPPAKRLRLSPEAQSPFPTQNQVGTPTGQPSTPSGGASVNGAAPPVPRPGLMAPPQRPPDKTADNNYEDILSGTGINIEEEARMLVRPDYYNNPTPQTPLQSRPGGLDSRQNSFTEASPGGDVLGGSQQLGDGPPQTQGYQPTAEEVQQREEGRQDWEAARHSQHPLWDMFLQGGALNERIRNISISEHLVDPQSGVLVNTQKVGPPPTVRVNGLEGASRVIDKGQAILDTGQKGERLSEIMKVISLAAKARLSGLVSASSRMSLERLEHSKGRIPEDWKDIAVAARPMIDLPESALSPTGSTGLKRTFSQSQANSEPSGPGDQIPSVPRVTDALEKSSTSERKAEDARRLRRLKRRTATNADGTAGSSVEAAEEAALAAALESEKKTTKKERKLAESKFSEQQQHKSANEAARMAVSGLLGRGKKQRTYDWMNASKGAGASPAATPGRPLVSGASSAVGTPAPERARPAVKEKQFGQWDEGKESKIQARDVFLVLESDGRASRSYLRGLSLPEN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.47
2	0.47
3	0.49
4	0.51
5	0.6
6	0.55
7	0.59
8	0.6
9	0.62
10	0.59
11	0.6
12	0.64
13	0.62
14	0.61
15	0.6
16	0.62
17	0.6
18	0.57
19	0.56
20	0.51
21	0.47
22	0.46
23	0.44
24	0.34
25	0.33
26	0.34
27	0.35
28	0.33
29	0.3
30	0.29
31	0.28
32	0.29
33	0.25
34	0.23
35	0.21
36	0.26
37	0.24
38	0.23
39	0.2
40	0.2
41	0.2
42	0.2
43	0.18
44	0.12
45	0.11
46	0.11
47	0.1
48	0.1
49	0.12
50	0.14
51	0.14
52	0.13
53	0.16
54	0.18
55	0.26
56	0.33
57	0.4
58	0.4
59	0.48
60	0.55
61	0.56
62	0.56
63	0.52
64	0.52
65	0.52
66	0.55
67	0.55
68	0.57
69	0.57
70	0.56
71	0.52
72	0.44
73	0.35
74	0.29
75	0.2
76	0.12
77	0.08
78	0.07
79	0.08
80	0.07
81	0.07
82	0.07
83	0.07
84	0.06
85	0.07
86	0.07
87	0.06
88	0.06
89	0.08
90	0.08
91	0.11
92	0.12
93	0.16
94	0.22
95	0.28
96	0.35
97	0.36
98	0.39
99	0.37
100	0.4
101	0.39
102	0.4
103	0.39
104	0.37
105	0.41
106	0.4
107	0.4
108	0.39
109	0.39
110	0.34
111	0.31
112	0.34
113	0.3
114	0.31
115	0.33
116	0.3
117	0.28
118	0.27
119	0.26
120	0.23
121	0.21
122	0.17
123	0.16
124	0.15
125	0.13
126	0.12
127	0.11
128	0.07
129	0.08
130	0.06
131	0.06
132	0.06
133	0.06
134	0.06
135	0.07
136	0.07
137	0.06
138	0.06
139	0.09
140	0.1
141	0.11
142	0.12
143	0.15
144	0.17
145	0.18
146	0.17
147	0.18
148	0.18
149	0.2
150	0.22
151	0.2
152	0.21
153	0.24
154	0.25
155	0.23
156	0.24
157	0.23
158	0.22
159	0.21
160	0.21
161	0.17
162	0.2
163	0.22
164	0.22
165	0.23
166	0.23
167	0.25
168	0.24
169	0.25
170	0.25
171	0.22
172	0.23
173	0.21
174	0.18
175	0.15
176	0.13
177	0.11
178	0.09
179	0.09
180	0.06
181	0.07
182	0.08
183	0.08
184	0.09
185	0.1
186	0.1
187	0.1
188	0.1
189	0.1
190	0.11
191	0.13
192	0.14
193	0.13
194	0.14
195	0.13
196	0.12
197	0.11
198	0.09
199	0.07
200	0.06
201	0.05
202	0.07
203	0.09
204	0.09
205	0.1
206	0.1
207	0.11
208	0.12
209	0.14
210	0.14
211	0.13
212	0.17
213	0.21
214	0.24
215	0.23
216	0.23
217	0.23
218	0.23
219	0.21
220	0.18
221	0.13
222	0.11
223	0.11
224	0.1
225	0.08
226	0.06
227	0.07
228	0.06
229	0.07
230	0.06
231	0.06
232	0.07
233	0.08
234	0.1
235	0.09
236	0.1
237	0.09
238	0.09
239	0.09
240	0.09
241	0.08
242	0.08
243	0.08
244	0.1
245	0.1
246	0.1
247	0.1
248	0.09
249	0.09
250	0.08
251	0.08
252	0.06
253	0.07
254	0.07
255	0.08
256	0.08
257	0.08
258	0.08
259	0.08
260	0.08
261	0.08
262	0.09
263	0.1
264	0.09
265	0.09
266	0.09
267	0.08
268	0.08
269	0.06
270	0.08
271	0.11
272	0.14
273	0.17
274	0.18
275	0.2
276	0.24
277	0.25
278	0.28
279	0.28
280	0.28
281	0.3
282	0.34
283	0.33
284	0.28
285	0.26
286	0.23
287	0.19
288	0.17
289	0.13
290	0.08
291	0.07
292	0.07
293	0.07
294	0.07
295	0.07
296	0.05
297	0.06
298	0.07
299	0.06
300	0.06
301	0.07
302	0.07
303	0.07
304	0.07
305	0.08
306	0.07
307	0.07
308	0.1
309	0.12
310	0.14
311	0.15
312	0.19
313	0.21
314	0.25
315	0.32
316	0.31
317	0.34
318	0.36
319	0.37
320	0.34
321	0.3
322	0.27
323	0.21
324	0.2
325	0.14
326	0.11
327	0.1
328	0.09
329	0.11
330	0.12
331	0.13
332	0.12
333	0.12
334	0.12
335	0.12
336	0.13
337	0.17
338	0.17
339	0.18
340	0.19
341	0.19
342	0.21
343	0.28
344	0.28
345	0.24
346	0.27
347	0.24
348	0.28
349	0.34
350	0.37
351	0.4
352	0.48
353	0.54
354	0.6
355	0.66
356	0.7
357	0.73
358	0.76
359	0.77
360	0.76
361	0.79
362	0.78
363	0.79
364	0.77
365	0.74
366	0.67
367	0.57
368	0.49
369	0.39
370	0.3
371	0.21
372	0.15
373	0.08
374	0.06
375	0.05
376	0.05
377	0.04
378	0.03
379	0.03
380	0.03
381	0.03
382	0.03
383	0.03
384	0.02
385	0.03
386	0.03
387	0.04
388	0.05
389	0.07
390	0.11
391	0.13
392	0.2
393	0.3
394	0.41
395	0.5
396	0.58
397	0.65
398	0.71
399	0.8
400	0.82
401	0.81
402	0.77
403	0.71
404	0.69
405	0.65
406	0.63
407	0.57
408	0.56
409	0.53
410	0.53
411	0.49
412	0.47
413	0.49
414	0.45
415	0.43
416	0.37
417	0.31
418	0.25
419	0.25
420	0.2
421	0.15
422	0.1
423	0.08
424	0.08
425	0.12
426	0.12
427	0.15
428	0.23
429	0.26
430	0.31
431	0.35
432	0.41
433	0.45
434	0.54
435	0.59
436	0.62
437	0.65
438	0.62
439	0.59
440	0.52
441	0.46
442	0.37
443	0.28
444	0.19
445	0.12
446	0.12
447	0.1
448	0.16
449	0.15
450	0.14
451	0.15
452	0.16
453	0.18
454	0.17
455	0.17
456	0.14
457	0.15
458	0.16
459	0.15
460	0.14
461	0.12
462	0.12
463	0.12
464	0.1
465	0.09
466	0.09
467	0.15
468	0.16
469	0.17
470	0.21
471	0.26
472	0.33
473	0.37
474	0.44
475	0.48
476	0.51
477	0.57
478	0.56
479	0.6
480	0.59
481	0.58
482	0.56
483	0.53
484	0.5
485	0.5
486	0.5
487	0.42
488	0.38
489	0.4
490	0.39
491	0.37
492	0.38
493	0.34
494	0.36
495	0.37
496	0.36
497	0.32
498	0.27
499	0.24
500	0.19
501	0.18
502	0.14
503	0.13
504	0.13
505	0.14
506	0.14
507	0.15
508	0.21
509	0.23
510	0.27
511	0.27
512	0.29
513	0.3

A0A072PB71

3D AlphaFold-predicted Structure Viewer