Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PH91

Protein Details
Accession A0A072PH91   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-33SKSCGTCRIRRKGGCDRKRPFCRHCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MVGVPGRSKSCGTCRIRRKGGCDRKRPFCRHCLKLRLKCDGYGRNTVFVTSTTRSPPRYRGEAAEWQITLPNALARSAHEERYFDIFWRTYLPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.74
4 0.74
5 0.75
6 0.76
7 0.8
8 0.8
9 0.81
10 0.79
11 0.81
12 0.86
13 0.86
14 0.8
15 0.8
16 0.79
17 0.76
18 0.77
19 0.77
20 0.77
21 0.77
22 0.77
23 0.76
24 0.68
25 0.63
26 0.6
27 0.57
28 0.5
29 0.49
30 0.44
31 0.38
32 0.36
33 0.33
34 0.27
35 0.2
36 0.2
37 0.13
38 0.14
39 0.16
40 0.19
41 0.22
42 0.24
43 0.3
44 0.32
45 0.36
46 0.36
47 0.36
48 0.38
49 0.43
50 0.44
51 0.4
52 0.34
53 0.29
54 0.29
55 0.25
56 0.2
57 0.12
58 0.11
59 0.09
60 0.09
61 0.09
62 0.1
63 0.18
64 0.21
65 0.25
66 0.25
67 0.25
68 0.28
69 0.33
70 0.33
71 0.26
72 0.28
73 0.24
74 0.23