FuNGI

Q6CFB9

Protein Details

Accession

Q6CFB9

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
302-321	VPAPRKRRAARGKRAKFDDE	Basic

NLS Segment(s)

Position	Sequence
304-317	APRKRRAARGKRAK

Subcellular Location(s)

cyto 15.5, cyto_nucl 14, nucl 11.5

Family & Domain DBs

InterPro	View protein in InterPro IPR039781 Rad21/Rec8-like IPR006909 Rad21/Rec8_C_eu IPR006910 Rad21_Rec8_N IPR023093 ScpA-like_C IPR036390 WH_DNA-bd_sf
Gene Ontology	GO:0008278 C:cohesin complex GO:0005634 C:nucleus GO:0003682 F:chromatin binding GO:0007064 P:mitotic sister chromatid cohesion GO:1990414 P:replication-born double-strand break repair via sister chromatid exchange
KEGG	yli:YALI0B08470g -
Pfam	View protein in Pfam PF04824 Rad21_Rec8 PF04825 Rad21_Rec8_N

Amino Acid Sequences

MFFSEQLLTDRGPLAQVWLAANLEKKLKRSDLLNTDIPKSVKAIVDSEKKVPMALRLSGQLLLGVVRIYGRQTGYLLDDCSHTVTKIKMTFKPGNVDLPTVSSGGKNTSKASAALTLGNAITDLDLALPPAPVIPGLNLPGLNLGLDEFMPVSNANLVSNATDITLPQHDMSIEIGRADEEDELADLGDDLDLDLGLDLDGELNLDEPAGEEAANQSIEIPRGDDDELANLDDGLDLGLDLGADNLEEELAAQQASEQLDLPMSPIEPADDVLLEEEDGLTLEEPTINMADALAGNIPEPSVPAPRKRRAARGKRAKFDDETQLDQDFVQQQRRNRDGIIYEHPQLEAFEKEVNLFNDLSADIMALVDPETIRKTLSSREVRDGDDEEQVMTPAASPNGKRGFEEVEQEVADQHADLPMDFDIPDDIVMDNTETVDEIAAAAADEEEDLLVTGTVDGIAKSTIATAQTLRRQMSGDNDKVQFSEMIAGKGRKAAVQSFFEVLVLATKDTISINQPQPYADFSVSAKDNLFDDMWSETNTEIAA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.15
3	0.16
4	0.15
5	0.16
6	0.17
7	0.18
8	0.21
9	0.2
10	0.27
11	0.28
12	0.31
13	0.36
14	0.39
15	0.4
16	0.42
17	0.48
18	0.48
19	0.52
20	0.56
21	0.52
22	0.51
23	0.53
24	0.49
25	0.4
26	0.34
27	0.31
28	0.27
29	0.25
30	0.27
31	0.3
32	0.38
33	0.41
34	0.43
35	0.42
36	0.4
37	0.39
38	0.36
39	0.34
40	0.3
41	0.29
42	0.27
43	0.26
44	0.28
45	0.27
46	0.26
47	0.2
48	0.15
49	0.13
50	0.11
51	0.08
52	0.06
53	0.06
54	0.07
55	0.08
56	0.11
57	0.11
58	0.12
59	0.13
60	0.14
61	0.18
62	0.19
63	0.2
64	0.17
65	0.18
66	0.17
67	0.2
68	0.19
69	0.16
70	0.16
71	0.17
72	0.22
73	0.28
74	0.33
75	0.34
76	0.42
77	0.49
78	0.49
79	0.55
80	0.51
81	0.51
82	0.47
83	0.44
84	0.36
85	0.31
86	0.29
87	0.22
88	0.21
89	0.14
90	0.14
91	0.18
92	0.2
93	0.19
94	0.2
95	0.21
96	0.22
97	0.22
98	0.23
99	0.21
100	0.19
101	0.18
102	0.16
103	0.15
104	0.14
105	0.13
106	0.11
107	0.08
108	0.06
109	0.05
110	0.05
111	0.04
112	0.04
113	0.05
114	0.05
115	0.05
116	0.05
117	0.05
118	0.05
119	0.05
120	0.05
121	0.06
122	0.07
123	0.09
124	0.1
125	0.1
126	0.1
127	0.11
128	0.1
129	0.09
130	0.07
131	0.06
132	0.05
133	0.05
134	0.05
135	0.05
136	0.05
137	0.05
138	0.05
139	0.06
140	0.07
141	0.07
142	0.07
143	0.07
144	0.08
145	0.08
146	0.08
147	0.08
148	0.06
149	0.06
150	0.06
151	0.08
152	0.09
153	0.1
154	0.1
155	0.1
156	0.09
157	0.1
158	0.12
159	0.11
160	0.1
161	0.09
162	0.09
163	0.08
164	0.09
165	0.09
166	0.07
167	0.05
168	0.05
169	0.05
170	0.05
171	0.05
172	0.04
173	0.04
174	0.04
175	0.03
176	0.03
177	0.03
178	0.03
179	0.03
180	0.03
181	0.03
182	0.02
183	0.02
184	0.02
185	0.02
186	0.03
187	0.03
188	0.03
189	0.03
190	0.03
191	0.03
192	0.03
193	0.03
194	0.03
195	0.04
196	0.04
197	0.04
198	0.04
199	0.05
200	0.06
201	0.06
202	0.05
203	0.06
204	0.07
205	0.08
206	0.08
207	0.08
208	0.07
209	0.09
210	0.1
211	0.09
212	0.08
213	0.09
214	0.09
215	0.09
216	0.09
217	0.07
218	0.06
219	0.05
220	0.05
221	0.03
222	0.03
223	0.02
224	0.02
225	0.02
226	0.02
227	0.02
228	0.02
229	0.02
230	0.02
231	0.02
232	0.02
233	0.02
234	0.02
235	0.02
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.05
242	0.06
243	0.06
244	0.06
245	0.06
246	0.06
247	0.06
248	0.07
249	0.05
250	0.05
251	0.05
252	0.04
253	0.05
254	0.05
255	0.05
256	0.05
257	0.04
258	0.04
259	0.04
260	0.04
261	0.04
262	0.04
263	0.03
264	0.03
265	0.03
266	0.03
267	0.03
268	0.03
269	0.03
270	0.03
271	0.03
272	0.04
273	0.04
274	0.04
275	0.03
276	0.03
277	0.04
278	0.03
279	0.04
280	0.04
281	0.03
282	0.04
283	0.04
284	0.04
285	0.03
286	0.04
287	0.05
288	0.11
289	0.13
290	0.22
291	0.3
292	0.36
293	0.45
294	0.48
295	0.57
296	0.62
297	0.71
298	0.74
299	0.77
300	0.8
301	0.78
302	0.8
303	0.74
304	0.66
305	0.58
306	0.57
307	0.48
308	0.43
309	0.37
310	0.32
311	0.29
312	0.25
313	0.24
314	0.19
315	0.18
316	0.23
317	0.25
318	0.29
319	0.37
320	0.4
321	0.39
322	0.35
323	0.35
324	0.3
325	0.32
326	0.34
327	0.29
328	0.29
329	0.28
330	0.27
331	0.25
332	0.22
333	0.19
334	0.13
335	0.11
336	0.1
337	0.1
338	0.11
339	0.14
340	0.14
341	0.14
342	0.14
343	0.12
344	0.12
345	0.11
346	0.1
347	0.07
348	0.06
349	0.04
350	0.04
351	0.04
352	0.03
353	0.04
354	0.04
355	0.04
356	0.05
357	0.07
358	0.07
359	0.08
360	0.08
361	0.1
362	0.14
363	0.24
364	0.31
365	0.33
366	0.4
367	0.42
368	0.43
369	0.44
370	0.42
371	0.35
372	0.29
373	0.26
374	0.19
375	0.17
376	0.16
377	0.13
378	0.1
379	0.08
380	0.07
381	0.09
382	0.1
383	0.11
384	0.18
385	0.24
386	0.25
387	0.25
388	0.26
389	0.3
390	0.29
391	0.33
392	0.27
393	0.23
394	0.23
395	0.22
396	0.2
397	0.15
398	0.13
399	0.09
400	0.07
401	0.06
402	0.06
403	0.06
404	0.07
405	0.07
406	0.08
407	0.08
408	0.08
409	0.07
410	0.07
411	0.07
412	0.06
413	0.06
414	0.06
415	0.06
416	0.07
417	0.06
418	0.06
419	0.06
420	0.05
421	0.05
422	0.05
423	0.05
424	0.04
425	0.04
426	0.04
427	0.04
428	0.04
429	0.03
430	0.03
431	0.03
432	0.03
433	0.03
434	0.03
435	0.03
436	0.03
437	0.04
438	0.04
439	0.04
440	0.04
441	0.04
442	0.05
443	0.04
444	0.05
445	0.05
446	0.05
447	0.05
448	0.06
449	0.07
450	0.08
451	0.09
452	0.12
453	0.18
454	0.25
455	0.3
456	0.31
457	0.31
458	0.31
459	0.32
460	0.39
461	0.42
462	0.41
463	0.43
464	0.43
465	0.42
466	0.42
467	0.41
468	0.31
469	0.23
470	0.25
471	0.19
472	0.2
473	0.25
474	0.26
475	0.25
476	0.28
477	0.28
478	0.22
479	0.24
480	0.28
481	0.28
482	0.31
483	0.33
484	0.32
485	0.31
486	0.29
487	0.26
488	0.2
489	0.17
490	0.14
491	0.12
492	0.1
493	0.1
494	0.11
495	0.11
496	0.13
497	0.13
498	0.21
499	0.27
500	0.31
501	0.32
502	0.32
503	0.33
504	0.34
505	0.35
506	0.27
507	0.23
508	0.19
509	0.25
510	0.26
511	0.26
512	0.23
513	0.2
514	0.2
515	0.21
516	0.21
517	0.14
518	0.14
519	0.16
520	0.17
521	0.17
522	0.17
523	0.14

Q6CFB9

3D AlphaFold-predicted Structure Viewer