Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PC17

Protein Details
Accession A0A072PC17   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSQARKRRSKGKQAVKELRTSSHydrophilic
NLS Segment(s)
PositionSequence
5-12RKRRSKGK
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039632  TMEM42  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQARKRRSKGKQAVKELRTSSSSDISHDILPEDMTATSSIVAALRRQPVWIVLAVSSGACAAFNGVFAKLTTTSLTSTLSSHIALLLSLSATNKIVEFLVRGTFFLLNLAFNAAMWALFTAALTRADSTTRVSIVNVSANFMITAVLGWIIFSEKLNGLWWGGASLLAIGNVVIGRREEAKKPGGPSGLDETAGQAVESEGLLRTSGDGEDLLELDNTADSTSPRLGRGGADDYRRLKRAEEADSPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.85
3 0.83
4 0.74
5 0.68
6 0.59
7 0.51
8 0.44
9 0.4
10 0.36
11 0.31
12 0.31
13 0.29
14 0.27
15 0.25
16 0.22
17 0.16
18 0.16
19 0.13
20 0.11
21 0.09
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.08
29 0.09
30 0.1
31 0.15
32 0.18
33 0.18
34 0.19
35 0.19
36 0.19
37 0.2
38 0.2
39 0.16
40 0.12
41 0.12
42 0.12
43 0.11
44 0.09
45 0.07
46 0.05
47 0.04
48 0.04
49 0.05
50 0.04
51 0.05
52 0.06
53 0.07
54 0.07
55 0.07
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.11
63 0.13
64 0.11
65 0.11
66 0.12
67 0.12
68 0.11
69 0.1
70 0.09
71 0.08
72 0.07
73 0.07
74 0.05
75 0.04
76 0.04
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.09
88 0.09
89 0.09
90 0.1
91 0.1
92 0.09
93 0.1
94 0.09
95 0.06
96 0.06
97 0.07
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.1
123 0.13
124 0.11
125 0.11
126 0.1
127 0.1
128 0.1
129 0.09
130 0.08
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.06
142 0.06
143 0.07
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.06
150 0.06
151 0.05
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.04
160 0.04
161 0.04
162 0.04
163 0.06
164 0.1
165 0.13
166 0.16
167 0.21
168 0.26
169 0.3
170 0.32
171 0.35
172 0.33
173 0.31
174 0.32
175 0.34
176 0.29
177 0.26
178 0.23
179 0.2
180 0.18
181 0.18
182 0.14
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.05
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.08
200 0.08
201 0.07
202 0.07
203 0.06
204 0.07
205 0.06
206 0.06
207 0.06
208 0.06
209 0.09
210 0.14
211 0.15
212 0.16
213 0.17
214 0.17
215 0.18
216 0.22
217 0.26
218 0.27
219 0.3
220 0.36
221 0.42
222 0.47
223 0.49
224 0.46
225 0.41
226 0.44
227 0.46
228 0.46