Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C962

Protein Details
Accession Q6C962    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-126LATKVEKASRQQRKQRKNRDKKVRGTGVKLAHydrophilic
NLS Segment(s)
PositionSequence
102-134KASRQQRKQRKNRDKKVRGTGVKLAAKKKKKAE
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG yli:YALI0D13728g  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSVTIRTRKFIRNPLLGRRQFVVDILHPSSANVSKDELREKLAGAYNSEKDAVSVFGLRTQFGGGKTTGFGLIYDSPEALLKFEPAYRQVRYGLATKVEKASRQQRKQRKNRDKKVRGTGVKLAAKKKKKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.72
4 0.77
5 0.72
6 0.67
7 0.59
8 0.53
9 0.43
10 0.38
11 0.32
12 0.24
13 0.26
14 0.24
15 0.24
16 0.21
17 0.2
18 0.22
19 0.22
20 0.21
21 0.16
22 0.17
23 0.19
24 0.22
25 0.26
26 0.23
27 0.23
28 0.22
29 0.21
30 0.23
31 0.24
32 0.22
33 0.21
34 0.23
35 0.21
36 0.21
37 0.22
38 0.18
39 0.14
40 0.13
41 0.11
42 0.08
43 0.08
44 0.07
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.1
52 0.12
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.09
64 0.08
65 0.08
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.07
72 0.08
73 0.1
74 0.13
75 0.18
76 0.18
77 0.19
78 0.2
79 0.21
80 0.22
81 0.24
82 0.22
83 0.24
84 0.24
85 0.24
86 0.28
87 0.28
88 0.29
89 0.33
90 0.41
91 0.46
92 0.55
93 0.63
94 0.69
95 0.78
96 0.87
97 0.91
98 0.92
99 0.93
100 0.94
101 0.95
102 0.94
103 0.93
104 0.93
105 0.92
106 0.87
107 0.82
108 0.79
109 0.77
110 0.74
111 0.7
112 0.69
113 0.68
114 0.71