Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072NUU7

Protein Details
Accession A0A072NUU7    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65ALERKEAKRKKRELEQQQALEHydrophilic
114-138QRLALEKKEAKRKKRELEQQQALERHydrophilic
NLS Segment(s)
PositionSequence
47-57ERKEAKRKKRE
84-129KKMAKQKKVILEQQKALEKREIKRKRVELEQRLALEKKEAKRKKRE
157-162KEAKRR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences QLCGTVVQLQNITEGEQCKAETAPNKAQETKDDMRKRSELEQRLALERKEAKRKKRELEQQQALERKEIKRQRIELEQQVALEKKMAKQKKVILEQQKALEKREIKRKRVELEQRLALEKKEAKRKKRELEQQQALERKEIKRQRIELEQQIALEKKEAKRRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.16
5 0.15
6 0.15
7 0.19
8 0.21
9 0.27
10 0.33
11 0.39
12 0.43
13 0.45
14 0.46
15 0.45
16 0.48
17 0.48
18 0.5
19 0.51
20 0.5
21 0.52
22 0.53
23 0.53
24 0.53
25 0.55
26 0.52
27 0.48
28 0.51
29 0.48
30 0.51
31 0.51
32 0.42
33 0.39
34 0.4
35 0.43
36 0.48
37 0.53
38 0.56
39 0.63
40 0.72
41 0.73
42 0.76
43 0.79
44 0.79
45 0.83
46 0.81
47 0.76
48 0.74
49 0.72
50 0.62
51 0.55
52 0.49
53 0.39
54 0.4
55 0.41
56 0.41
57 0.42
58 0.44
59 0.45
60 0.49
61 0.52
62 0.47
63 0.45
64 0.39
65 0.33
66 0.31
67 0.27
68 0.2
69 0.17
70 0.13
71 0.13
72 0.21
73 0.24
74 0.24
75 0.29
76 0.34
77 0.41
78 0.46
79 0.5
80 0.51
81 0.52
82 0.53
83 0.53
84 0.54
85 0.47
86 0.43
87 0.41
88 0.37
89 0.39
90 0.47
91 0.51
92 0.5
93 0.58
94 0.62
95 0.62
96 0.66
97 0.71
98 0.68
99 0.66
100 0.65
101 0.58
102 0.56
103 0.52
104 0.42
105 0.38
106 0.35
107 0.36
108 0.42
109 0.48
110 0.53
111 0.63
112 0.73
113 0.77
114 0.81
115 0.84
116 0.84
117 0.87
118 0.86
119 0.8
120 0.77
121 0.72
122 0.62
123 0.55
124 0.49
125 0.39
126 0.4
127 0.41
128 0.41
129 0.42
130 0.44
131 0.45
132 0.49
133 0.54
134 0.54
135 0.54
136 0.49
137 0.43
138 0.45
139 0.42
140 0.36
141 0.33
142 0.31
143 0.32
144 0.41