Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072PB94

Protein Details
Accession A0A072PB94    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26NRTACIRCRRKKKRCDQKLPRCSLCEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
cd14723  ZIP_Ppr1  
Amino Acid Sequences NRTACIRCRRKKKRCDQKLPRCSLCETAGAECVGYDAVAKRHVPRSYVHSLEERVAYLELKLQQHGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.95
3 0.95
4 0.95
5 0.95
6 0.93
7 0.86
8 0.78
9 0.69
10 0.61
11 0.51
12 0.43
13 0.34
14 0.26
15 0.23
16 0.19
17 0.17
18 0.12
19 0.11
20 0.07
21 0.05
22 0.05
23 0.04
24 0.06
25 0.08
26 0.09
27 0.12
28 0.19
29 0.2
30 0.22
31 0.23
32 0.29
33 0.34
34 0.36
35 0.35
36 0.32
37 0.33
38 0.33
39 0.32
40 0.25
41 0.19
42 0.18
43 0.16
44 0.13
45 0.16
46 0.19
47 0.2