Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C6B0

Protein Details
Accession Q6C6B0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-102SWLVKQQREKRLKSERQKVTQQERKHydrophilic
277-330GRDFRDRDPRDRDPRDRDRERDPRDRDRERRPQYRDRSPPRRERDRGDFRRGPABasic
NLS Segment(s)
PositionSequence
206-339RRLGGGKGGRHYTKESERKPLGPPMPPGGAGGRDLFPGHRDRGGPRSRDPRGSRPPEDYRDSFRGRGGGRGGRDFRDRDPRDRDPRDRDRERDPRDRDRERRPQYRDRSPPRRERDRGDFRRGPADRGGDRGGR
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR034143  snRNP70_RRM  
IPR022023  U1snRNP70_N  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0003729  F:mRNA binding  
GO:0030619  F:U1 snRNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG yli:YALI0E10989g  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF12220  U1snRNP70_N  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12236  RRM_snRNP70  
Amino Acid Sequences MVSICATFALQSTTRLTQAELERLPPHIQRLFPECPEPRYLEPIDYAPEDRRTQKISGVSAYMELLKQPDSEYVPTESWLVKQQREKRLKSERQKVTQQERKEAWDPKKDDKIVGDPFKTLFVARLAFDVTENDLEEHYIKFGPVKHVRIVRDLKSGKSNGYGFVEFQEEDDFRKAFQMTNGSIIKGRKVVVDVERGRTVSGWLPRRLGGGKGGRHYTKESERKPLGPPMPPGGAGGRDLFPGHRDRGGPRSRDPRGSRPPEDYRDSFRGRGGGRGGRDFRDRDPRDRDPRDRDRERDPRDRDRERRPQYRDRSPPRRERDRGDFRRGPADRGGDRGGREPTKYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.26
5 0.29
6 0.34
7 0.31
8 0.33
9 0.32
10 0.35
11 0.38
12 0.34
13 0.36
14 0.33
15 0.33
16 0.34
17 0.4
18 0.42
19 0.41
20 0.47
21 0.44
22 0.43
23 0.45
24 0.46
25 0.41
26 0.42
27 0.41
28 0.34
29 0.33
30 0.31
31 0.3
32 0.27
33 0.27
34 0.25
35 0.29
36 0.31
37 0.32
38 0.35
39 0.35
40 0.35
41 0.37
42 0.38
43 0.36
44 0.34
45 0.32
46 0.28
47 0.25
48 0.24
49 0.2
50 0.15
51 0.12
52 0.11
53 0.11
54 0.1
55 0.11
56 0.13
57 0.15
58 0.16
59 0.18
60 0.2
61 0.2
62 0.2
63 0.21
64 0.18
65 0.17
66 0.24
67 0.26
68 0.28
69 0.36
70 0.44
71 0.53
72 0.62
73 0.64
74 0.65
75 0.72
76 0.77
77 0.79
78 0.81
79 0.8
80 0.78
81 0.83
82 0.83
83 0.82
84 0.8
85 0.73
86 0.71
87 0.64
88 0.63
89 0.61
90 0.6
91 0.57
92 0.58
93 0.59
94 0.58
95 0.64
96 0.59
97 0.54
98 0.48
99 0.48
100 0.47
101 0.48
102 0.41
103 0.33
104 0.33
105 0.32
106 0.29
107 0.22
108 0.15
109 0.11
110 0.12
111 0.11
112 0.11
113 0.11
114 0.1
115 0.1
116 0.1
117 0.09
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.09
124 0.08
125 0.08
126 0.07
127 0.07
128 0.08
129 0.1
130 0.19
131 0.23
132 0.26
133 0.29
134 0.34
135 0.35
136 0.41
137 0.44
138 0.38
139 0.41
140 0.4
141 0.37
142 0.38
143 0.38
144 0.31
145 0.3
146 0.28
147 0.21
148 0.22
149 0.21
150 0.16
151 0.16
152 0.16
153 0.12
154 0.12
155 0.12
156 0.09
157 0.1
158 0.12
159 0.11
160 0.09
161 0.11
162 0.11
163 0.1
164 0.11
165 0.14
166 0.13
167 0.19
168 0.19
169 0.18
170 0.2
171 0.2
172 0.2
173 0.17
174 0.17
175 0.12
176 0.12
177 0.15
178 0.15
179 0.24
180 0.24
181 0.26
182 0.27
183 0.26
184 0.25
185 0.22
186 0.21
187 0.16
188 0.22
189 0.24
190 0.25
191 0.26
192 0.26
193 0.29
194 0.28
195 0.25
196 0.25
197 0.25
198 0.27
199 0.29
200 0.34
201 0.32
202 0.33
203 0.35
204 0.34
205 0.37
206 0.43
207 0.42
208 0.47
209 0.49
210 0.5
211 0.5
212 0.53
213 0.48
214 0.43
215 0.43
216 0.38
217 0.36
218 0.33
219 0.31
220 0.23
221 0.2
222 0.17
223 0.15
224 0.12
225 0.11
226 0.11
227 0.11
228 0.12
229 0.15
230 0.16
231 0.17
232 0.19
233 0.21
234 0.31
235 0.37
236 0.39
237 0.43
238 0.51
239 0.52
240 0.6
241 0.63
242 0.64
243 0.67
244 0.71
245 0.68
246 0.66
247 0.7
248 0.67
249 0.68
250 0.61
251 0.57
252 0.56
253 0.56
254 0.5
255 0.43
256 0.43
257 0.37
258 0.38
259 0.36
260 0.34
261 0.33
262 0.39
263 0.41
264 0.39
265 0.44
266 0.42
267 0.42
268 0.48
269 0.5
270 0.5
271 0.56
272 0.62
273 0.67
274 0.73
275 0.77
276 0.76
277 0.82
278 0.84
279 0.84
280 0.79
281 0.79
282 0.8
283 0.79
284 0.8
285 0.77
286 0.78
287 0.79
288 0.85
289 0.83
290 0.83
291 0.86
292 0.86
293 0.88
294 0.85
295 0.86
296 0.85
297 0.87
298 0.88
299 0.88
300 0.88
301 0.88
302 0.91
303 0.9
304 0.91
305 0.87
306 0.85
307 0.85
308 0.85
309 0.84
310 0.84
311 0.8
312 0.73
313 0.76
314 0.69
315 0.62
316 0.58
317 0.57
318 0.48
319 0.47
320 0.49
321 0.42
322 0.43
323 0.44
324 0.46
325 0.41