Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C509

Protein Details
Accession Q6C509   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
314-335QGKTNLKRRRVLKSLRSQIKEHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007133  RNA_pol_II-assoc_Paf1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0003682  F:chromatin binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG yli:YALI0E22022g  -  
Pfam View protein in Pfam  
PF03985  Paf1  
Amino Acid Sequences MSRRQDYLVRVRYQNELPPPELPPKMLNIPVPPEKLTSLGINILSDMQRRESPQINVDNDLGMPLDLTEIRGVFEQDDESGLLPLENLPELDPRDLVLLKEPQSTGNKSQPGVAFLRRTEYISSEVSGGRKLETLSASQRRLAQKTLEESFQDPESQLRAVEATFEAANTDIKTLKHPKKPHLTAVESFPILPNSQIFDLTFLTMKMVGSAVGVPPLPDGSPDPKMSVSLFRPMTLETDEWMSMFLTKDEESKDLKRQLDSTDEHVADDKHVYRFEHKRDYDMDLQMNASQFEEIVIDVDLDKPGSVAHYVPVQGKTNLKRRRVLKSLRSQIKEHNIAAIDLTLRDITAEESILRDNTRAEYDPVSYTVMDLPESEEEDEEDEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.5
4 0.46
5 0.45
6 0.46
7 0.48
8 0.45
9 0.4
10 0.33
11 0.33
12 0.36
13 0.37
14 0.36
15 0.33
16 0.39
17 0.44
18 0.45
19 0.41
20 0.38
21 0.35
22 0.34
23 0.31
24 0.25
25 0.21
26 0.2
27 0.2
28 0.17
29 0.17
30 0.17
31 0.17
32 0.18
33 0.18
34 0.18
35 0.21
36 0.24
37 0.28
38 0.32
39 0.33
40 0.38
41 0.44
42 0.43
43 0.43
44 0.4
45 0.36
46 0.3
47 0.26
48 0.19
49 0.11
50 0.09
51 0.06
52 0.07
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.09
59 0.1
60 0.09
61 0.1
62 0.1
63 0.09
64 0.1
65 0.09
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.1
77 0.12
78 0.13
79 0.12
80 0.12
81 0.14
82 0.15
83 0.14
84 0.16
85 0.19
86 0.2
87 0.23
88 0.23
89 0.25
90 0.29
91 0.33
92 0.34
93 0.36
94 0.38
95 0.35
96 0.39
97 0.36
98 0.34
99 0.33
100 0.32
101 0.28
102 0.25
103 0.29
104 0.25
105 0.26
106 0.23
107 0.22
108 0.21
109 0.18
110 0.19
111 0.16
112 0.17
113 0.16
114 0.17
115 0.15
116 0.12
117 0.12
118 0.12
119 0.13
120 0.13
121 0.15
122 0.21
123 0.27
124 0.28
125 0.29
126 0.35
127 0.37
128 0.38
129 0.37
130 0.32
131 0.3
132 0.33
133 0.33
134 0.29
135 0.26
136 0.25
137 0.24
138 0.22
139 0.19
140 0.14
141 0.13
142 0.12
143 0.11
144 0.1
145 0.08
146 0.08
147 0.07
148 0.08
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.07
156 0.06
157 0.07
158 0.08
159 0.08
160 0.14
161 0.23
162 0.31
163 0.38
164 0.43
165 0.5
166 0.58
167 0.62
168 0.63
169 0.61
170 0.57
171 0.51
172 0.5
173 0.44
174 0.34
175 0.3
176 0.23
177 0.17
178 0.13
179 0.12
180 0.08
181 0.07
182 0.07
183 0.08
184 0.07
185 0.08
186 0.08
187 0.09
188 0.08
189 0.07
190 0.07
191 0.07
192 0.07
193 0.05
194 0.05
195 0.04
196 0.04
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.07
207 0.1
208 0.13
209 0.14
210 0.15
211 0.15
212 0.16
213 0.16
214 0.19
215 0.17
216 0.21
217 0.2
218 0.2
219 0.2
220 0.2
221 0.21
222 0.18
223 0.17
224 0.11
225 0.12
226 0.12
227 0.11
228 0.11
229 0.09
230 0.08
231 0.08
232 0.08
233 0.08
234 0.08
235 0.1
236 0.11
237 0.14
238 0.17
239 0.2
240 0.27
241 0.32
242 0.33
243 0.33
244 0.34
245 0.33
246 0.36
247 0.34
248 0.32
249 0.32
250 0.3
251 0.29
252 0.28
253 0.26
254 0.21
255 0.22
256 0.2
257 0.15
258 0.17
259 0.18
260 0.25
261 0.32
262 0.38
263 0.45
264 0.43
265 0.45
266 0.46
267 0.5
268 0.49
269 0.46
270 0.41
271 0.31
272 0.31
273 0.29
274 0.27
275 0.21
276 0.15
277 0.11
278 0.09
279 0.08
280 0.07
281 0.06
282 0.06
283 0.05
284 0.05
285 0.06
286 0.07
287 0.07
288 0.06
289 0.06
290 0.06
291 0.05
292 0.07
293 0.07
294 0.07
295 0.08
296 0.11
297 0.13
298 0.17
299 0.2
300 0.22
301 0.24
302 0.32
303 0.38
304 0.46
305 0.52
306 0.55
307 0.59
308 0.62
309 0.69
310 0.71
311 0.73
312 0.74
313 0.76
314 0.81
315 0.83
316 0.81
317 0.75
318 0.74
319 0.73
320 0.69
321 0.58
322 0.53
323 0.44
324 0.4
325 0.37
326 0.29
327 0.2
328 0.14
329 0.15
330 0.1
331 0.08
332 0.09
333 0.08
334 0.08
335 0.09
336 0.09
337 0.08
338 0.1
339 0.12
340 0.14
341 0.14
342 0.14
343 0.14
344 0.16
345 0.2
346 0.22
347 0.22
348 0.23
349 0.25
350 0.26
351 0.26
352 0.26
353 0.21
354 0.2
355 0.2
356 0.18
357 0.16
358 0.14
359 0.15
360 0.15
361 0.18
362 0.17
363 0.15
364 0.15
365 0.17
366 0.17